Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 584534..585204 | Replicon | chromosome |
| Accession | NZ_LN868938 | ||
| Organism | Nocardia farcinica strain NCTC11134 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A0H5NFP9 |
| Locus tag | AMO33_RS03015 | Protein ID | WP_060590342.1 |
| Coordinates | 584534..584950 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0H5NWG5 |
| Locus tag | AMO33_RS03020 | Protein ID | WP_060590344.1 |
| Coordinates | 584947..585204 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AMO33_RS02990 | 579896..580585 | - | 690 | WP_011209958.1 | cyclodeaminase/cyclohydrolase family protein | - |
| AMO33_RS02995 | 580713..581750 | + | 1038 | WP_060590338.1 | LLM class F420-dependent oxidoreductase | - |
| AMO33_RS03000 | 581819..582157 | - | 339 | WP_011209956.1 | STAS domain-containing protein | - |
| AMO33_RS03005 | 582842..583246 | - | 405 | WP_197657723.1 | MarR family transcriptional regulator | - |
| AMO33_RS03010 | 583336..584061 | + | 726 | WP_060590340.1 | glucose 1-dehydrogenase | - |
| AMO33_RS03015 | 584534..584950 | - | 417 | WP_060590342.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| AMO33_RS03020 | 584947..585204 | - | 258 | WP_060590344.1 | hypothetical protein | Antitoxin |
| AMO33_RS03025 | 585735..586376 | - | 642 | WP_060590346.1 | LysE family translocator | - |
| AMO33_RS03030 | 586653..587189 | - | 537 | WP_011209949.1 | hypothetical protein | - |
| AMO33_RS03035 | 587233..588621 | - | 1389 | WP_011209948.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14982.91 Da Isoelectric Point: 4.4227
>T285724 WP_060590342.1 NZ_LN868938:c584950-584534 [Nocardia farcinica]
VIILDTNVISEPTTKAPDERVMAWLDAQVSETLYLSAVTVGELRYGIATMPSGRRRDEFTDWLENHTLPAFTGRILAYDL
NATTEYARLMSQARAQGLAIAVADGMIAATAAAAGFAVATRDRSPFEAADVPTIDPWH
VIILDTNVISEPTTKAPDERVMAWLDAQVSETLYLSAVTVGELRYGIATMPSGRRRDEFTDWLENHTLPAFTGRILAYDL
NATTEYARLMSQARAQGLAIAVADGMIAATAAAAGFAVATRDRSPFEAADVPTIDPWH
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H5NFP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H5NWG5 |