Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 479120..479773 | Replicon | chromosome |
| Accession | NZ_LN868200 | ||
| Organism | Acinetobacter baumannii isolate R2090 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | ABR2090_RS02350 | Protein ID | WP_000607097.1 |
| Coordinates | 479384..479773 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | ABR2090_RS02345 | Protein ID | WP_001288210.1 |
| Coordinates | 479120..479377 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABR2090_RS02325 | 474635..475642 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| ABR2090_RS02330 | 475661..476038 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| ABR2090_RS02335 | 476220..477710 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| ABR2090_RS02340 | 477760..478932 | - | 1173 | WP_001190546.1 | acyl-CoA dehydrogenase family protein | - |
| ABR2090_RS02345 | 479120..479377 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| ABR2090_RS02350 | 479384..479773 | + | 390 | WP_000607097.1 | hypothetical protein | Toxin |
| ABR2090_RS02355 | 480543..481628 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| ABR2090_RS02360 | 481706..482272 | + | 567 | WP_000651536.1 | rhombosortase | - |
| ABR2090_RS02365 | 482460..484655 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15637.89 Da Isoelectric Point: 10.3890
>T285722 WP_000607097.1 NZ_LN868200:479384-479773 [Acinetobacter baumannii]
MINHSNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
MINHSNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|