Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2779600..2780169 | Replicon | chromosome |
| Accession | NZ_LN865164 | ||
| Organism | Pseudomonas sp. URMO17WK12:I11 isolate Yellow | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PSHI_RS21960 | Protein ID | WP_082693189.1 |
| Coordinates | 2779600..2779908 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0S4IAP2 |
| Locus tag | PSHI_RS12560 | Protein ID | WP_059183628.1 |
| Coordinates | 2779939..2780169 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSHI_RS12535 | 2775782..2776192 | + | 411 | WP_027915709.1 | pilin | - |
| PSHI_RS12545 | 2776964..2778362 | + | 1399 | Protein_2455 | PAAR domain-containing protein | - |
| PSHI_RS12550 | 2778355..2778744 | + | 390 | WP_049695408.1 | hypothetical protein | - |
| PSHI_RS12555 | 2778822..2779343 | - | 522 | WP_059183627.1 | cysteine hydrolase | - |
| PSHI_RS21960 | 2779600..2779908 | - | 309 | WP_082693189.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PSHI_RS12560 | 2779939..2780169 | - | 231 | WP_059183628.1 | antitoxin | Antitoxin |
| PSHI_RS12565 | 2780622..2781152 | + | 531 | WP_028688070.1 | ATPase AAA | - |
| PSHI_RS12570 | 2781171..2783129 | - | 1959 | WP_059183629.1 | response regulator | - |
| PSHI_RS12575 | 2783341..2785116 | + | 1776 | WP_028688071.1 | sensor domain-containing phosphodiesterase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11323.94 Da Isoelectric Point: 7.1667
>T285721 WP_082693189.1 NZ_LN865164:c2779908-2779600 [Pseudomonas sp. URMO17WK12:I11]
MCISTVTLMELIYGAEKSSNSERNLTAVEGLAARLEVLTYDRNAAAHTGQLRVELARLGTPIGPFDQMIAGHARSQGLII
VTNNRREFERVPGLRSEDWVIR
MCISTVTLMELIYGAEKSSNSERNLTAVEGLAARLEVLTYDRNAAAHTGQLRVELARLGTPIGPFDQMIAGHARSQGLII
VTNNRREFERVPGLRSEDWVIR
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|