Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2215850..2216889 | Replicon | chromosome |
Accession | NZ_LN865164 | ||
Organism | Pseudomonas sp. URMO17WK12:I11 isolate Yellow |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PSHI_RS09925 | Protein ID | WP_027913401.1 |
Coordinates | 2215850..2216425 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A0S4I9D6 |
Locus tag | PSHI_RS09930 | Protein ID | WP_027913402.1 |
Coordinates | 2216422..2216889 (-) | Length | 156 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSHI_RS09905 | 2210931..2212772 | + | 1842 | WP_049695298.1 | amidohydrolase | - |
PSHI_RS09910 | 2213058..2213969 | - | 912 | WP_027913398.1 | LysR family transcriptional regulator | - |
PSHI_RS09915 | 2214098..2214895 | - | 798 | WP_059183535.1 | SDR family oxidoreductase | - |
PSHI_RS09920 | 2214895..2215671 | - | 777 | WP_027913400.1 | alpha/beta hydrolase | - |
PSHI_RS09925 | 2215850..2216425 | - | 576 | WP_027913401.1 | PIN domain-containing protein | Toxin |
PSHI_RS09930 | 2216422..2216889 | - | 468 | WP_027913402.1 | helix-turn-helix domain-containing protein | Antitoxin |
PSHI_RS09935 | 2217102..2218592 | - | 1491 | WP_059183536.1 | YifB family Mg chelatase-like AAA ATPase | - |
PSHI_RS09940 | 2218825..2220834 | + | 2010 | WP_059184128.1 | DUF4034 domain-containing protein | - |
PSHI_RS09945 | 2220870..2221127 | - | 258 | WP_027913405.1 | accessory factor UbiK family protein | - |
PSHI_RS09950 | 2221491..2221829 | + | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21955.26 Da Isoelectric Point: 5.5909
>T285720 WP_027913401.1 NZ_LN865164:c2216425-2215850 [Pseudomonas sp. URMO17WK12:I11]
MRHSPFTVIYDACVLYPAPLRDLLMHLALTGAYRARWSEQIHDEWTRNVLRNRPDVSETQLYRTVGLMNRAIPDSLVNDY
EPLVQGLDLPDEDDRHVLAAAIKCGASVIVTYNLKDFPAEILKRFEIEALHPDVFLSDIWDLDQAAVLKAVQKQRAALNN
PVYSPRELLDILLKQRLPETVKHLSNYELLI
MRHSPFTVIYDACVLYPAPLRDLLMHLALTGAYRARWSEQIHDEWTRNVLRNRPDVSETQLYRTVGLMNRAIPDSLVNDY
EPLVQGLDLPDEDDRHVLAAAIKCGASVIVTYNLKDFPAEILKRFEIEALHPDVFLSDIWDLDQAAVLKAVQKQRAALNN
PVYSPRELLDILLKQRLPETVKHLSNYELLI
Download Length: 576 bp
Antitoxin
Download Length: 156 a.a. Molecular weight: 17035.46 Da Isoelectric Point: 4.9896
>AT285720 WP_027913402.1 NZ_LN865164:c2216889-2216422 [Pseudomonas sp. URMO17WK12:I11]
MTTADLAQAILPDEKAITAAIESSRQIAAFVSTKLDTQRIELVDEAQQRQTVELPTFALRLLGDILNELALGNTVKVVPI
HAELTTQEGADMLNVSRPHLVKLLDEGLIPHTKTGSHRRVKFTDLMAYKADRDKASQAAMDELAAQAQELNMGYQ
MTTADLAQAILPDEKAITAAIESSRQIAAFVSTKLDTQRIELVDEAQQRQTVELPTFALRLLGDILNELALGNTVKVVPI
HAELTTQEGADMLNVSRPHLVKLLDEGLIPHTKTGSHRRVKFTDLMAYKADRDKASQAAMDELAAQAQELNMGYQ
Download Length: 468 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|