Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1768753..1769469 | Replicon | chromosome |
Accession | NZ_LN865164 | ||
Organism | Pseudomonas sp. URMO17WK12:I11 isolate Yellow |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PSHI_RS21840 | Protein ID | WP_080992932.1 |
Coordinates | 1768753..1768935 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0S4I868 |
Locus tag | PSHI_RS07995 | Protein ID | WP_049696767.1 |
Coordinates | 1769023..1769469 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSHI_RS07970 | 1764000..1764689 | + | 690 | WP_023535781.1 | ABC transporter permease | - |
PSHI_RS07975 | 1764803..1766008 | + | 1206 | WP_059183455.1 | methyltransferase | - |
PSHI_RS07980 | 1766430..1766720 | - | 291 | WP_059183456.1 | DUF3077 domain-containing protein | - |
PSHI_RS07985 | 1767381..1767629 | + | 249 | WP_023535804.1 | hypothetical protein | - |
PSHI_RS21840 | 1768753..1768935 | + | 183 | WP_080992932.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PSHI_RS07995 | 1769023..1769469 | + | 447 | WP_049696767.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PSHI_RS08000 | 1769767..1770924 | - | 1158 | WP_050587302.1 | HAMP domain-containing histidine kinase | - |
PSHI_RS08005 | 1770917..1771729 | - | 813 | WP_059183457.1 | alpha/beta hydrolase | - |
PSHI_RS08010 | 1772067..1772273 | + | 207 | WP_023535792.1 | DUF3079 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6809.81 Da Isoelectric Point: 11.4650
>T285719 WP_080992932.1 NZ_LN865164:1768753-1768935 [Pseudomonas sp. URMO17WK12:I11]
VHSRDIIKRLKDDGWVRVKGTDGSHQQFKHPTKKGRVTVPHPNKDVATGTLRNIWKQAGL
VHSRDIIKRLKDDGWVRVKGTDGSHQQFKHPTKKGRVTVPHPNKDVATGTLRNIWKQAGL
Download Length: 183 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16381.38 Da Isoelectric Point: 4.3924
>AT285719 WP_049696767.1 NZ_LN865164:1769023-1769469 [Pseudomonas sp. URMO17WK12:I11]
MKYPVVLHKDEDSDYGVTVPDVPGCFSAGETIDEALSEVQLALEMHFEGLVEDGEPLPQPQNIEIHRKDPAYADGIWAFV
EFDVTPYYGKSVRFNASLPEGLLKRIDDRVKEDSAYASRSGFLAAAALHELAKNLNEGIDALKTRKTV
MKYPVVLHKDEDSDYGVTVPDVPGCFSAGETIDEALSEVQLALEMHFEGLVEDGEPLPQPQNIEIHRKDPAYADGIWAFV
EFDVTPYYGKSVRFNASLPEGLLKRIDDRVKEDSAYASRSGFLAAAALHELAKNLNEGIDALKTRKTV
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|