Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3455214..3455867 | Replicon | chromosome |
Accession | NZ_LN865143 | ||
Organism | Acinetobacter baumannii isolate CIP70.10 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A3R9G864 |
Locus tag | ABCIP7010_RS16010 | Protein ID | WP_000607075.1 |
Coordinates | 3455214..3455603 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | ABCIP7010_RS16015 | Protein ID | WP_001288210.1 |
Coordinates | 3455610..3455867 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ABCIP7010_RS15995 | 3450332..3452527 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
ABCIP7010_RS16000 | 3452715..3453281 | - | 567 | WP_000651536.1 | rhombosortase | - |
ABCIP7010_RS16005 | 3453359..3454444 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
ABCIP7010_RS16010 | 3455214..3455603 | - | 390 | WP_000607075.1 | membrane protein | Toxin |
ABCIP7010_RS16015 | 3455610..3455867 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
ABCIP7010_RS16020 | 3456055..3457227 | + | 1173 | WP_032028213.1 | acyl-CoA dehydrogenase family protein | - |
ABCIP7010_RS16025 | 3457276..3458766 | - | 1491 | WP_031966421.1 | NAD(P)/FAD-dependent oxidoreductase | - |
ABCIP7010_RS16030 | 3458948..3459325 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
ABCIP7010_RS16035 | 3459344..3460351 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.94 Da Isoelectric Point: 10.3890
>T285717 WP_000607075.1 NZ_LN865143:c3455603-3455214 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R9G864 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BQM7 |