Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 2633020..2633657 Replicon chromosome
Accession NZ_LN854573
Organism Pseudomonas sp. URMO17WK12:I11 isolate Shine

Toxin (Protein)


Gene name vapC Uniprot ID A0A0S4HTZ4
Locus tag AWM52_RS11940 Protein ID WP_027922186.1
Coordinates 2633250..2633657 (+) Length 136 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A0S4HU52
Locus tag AWM52_RS11935 Protein ID WP_027922185.1
Coordinates 2633020..2633250 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AWM52_RS11895 2628228..2628500 + 273 WP_010464608.1 oxidative damage protection protein -
AWM52_RS11905 2629020..2629481 + 462 WP_027922180.1 DUF4234 domain-containing protein -
AWM52_RS11910 2629538..2629984 - 447 WP_027922181.1 hypothetical protein -
AWM52_RS11915 2630249..2630886 + 638 Protein_2365 hypothetical protein -
AWM52_RS11920 2630956..2631930 + 975 WP_059181798.1 alpha/beta fold hydrolase -
AWM52_RS11925 2631961..2632377 + 417 WP_027922183.1 hypothetical protein -
AWM52_RS11930 2632384..2632836 + 453 WP_059181799.1 hypothetical protein -
AWM52_RS11935 2633020..2633250 + 231 WP_027922185.1 antitoxin Antitoxin
AWM52_RS11940 2633250..2633657 + 408 WP_027922186.1 tRNA(fMet)-specific endonuclease VapC Toxin
AWM52_RS11945 2633740..2634066 - 327 WP_027922187.1 hypothetical protein -
AWM52_RS11950 2634446..2635837 - 1392 WP_027922188.1 GABA permease -
AWM52_RS11955 2636390..2637163 + 774 WP_027922189.1 ABC transporter ATP-binding protein -
AWM52_RS11960 2637177..2637923 + 747 WP_027922190.1 ABC transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2633020..2647607 14587


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-123)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 136 a.a.        Molecular weight: 14886.24 Da        Isoelectric Point: 6.4791

>T285715 WP_027922186.1 NZ_LN854573:2633250-2633657 [Pseudomonas sp. URMO17WK12:I11]
MIKFMLDTNICIFTIKNKPQIVREAFNLHDGQLCISAVTLMELIYGAEKSAAPEKNLAVVESFAARLEVLPFDNDAAAHT
GMIRSELARAGTPIGPYDSMISGHARSRGLIVVTNNLRELERVPGLRVEDWVHPA

Download         Length: 408 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8696.72 Da        Isoelectric Point: 4.3569

>AT285715 WP_027922185.1 NZ_LN854573:2633020-2633250 [Pseudomonas sp. URMO17WK12:I11]
MEQTTLFMSNRSQAVRLPKAVAMPSDVKRVNVIAIGRARIITPADETWDSWFDGDSVSADFMTDRDQPFEQERESF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0S4HTZ4

Antitoxin

Source ID Structure
AlphaFold DB A0A0S4HU52

References