Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09812-MazE |
Location | 2488500..2489131 | Replicon | chromosome |
Accession | NZ_LN854573 | ||
Organism | Pseudomonas sp. URMO17WK12:I11 isolate Shine |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0S4HTM0 |
Locus tag | AWM52_RS11270 | Protein ID | WP_059181764.1 |
Coordinates | 2488500..2488862 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A0S4HTP8 |
Locus tag | AWM52_RS11275 | Protein ID | WP_059181765.1 |
Coordinates | 2488862..2489131 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AWM52_RS11260 | 2483631..2486981 | + | 3351 | WP_027922063.1 | mechanosensitive channel MscK | - |
AWM52_RS11265 | 2487030..2488493 | + | 1464 | WP_059181763.1 | YdiU family protein | - |
AWM52_RS11270 | 2488500..2488862 | - | 363 | WP_059181764.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
AWM52_RS11275 | 2488862..2489131 | - | 270 | WP_059181765.1 | hypothetical protein | Antitoxin |
AWM52_RS11280 | 2489402..2489836 | + | 435 | WP_027922067.1 | thioredoxin TrxC | - |
AWM52_RS11285 | 2489967..2490737 | - | 771 | WP_027922068.1 | ParA family protein | - |
AWM52_RS11290 | 2491093..2491818 | + | 726 | WP_059181766.1 | beta-ketoacyl synthase chain length factor | - |
AWM52_RS11295 | 2491794..2492603 | + | 810 | WP_027922070.1 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | - |
AWM52_RS11300 | 2492584..2492844 | + | 261 | WP_027922071.1 | acyl carrier protein | - |
AWM52_RS11305 | 2492854..2493108 | + | 255 | WP_007947135.1 | acyl carrier protein | - |
AWM52_RS11310 | 2493105..2493650 | + | 546 | WP_027922072.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13042.82 Da Isoelectric Point: 6.4595
>T285714 WP_059181764.1 NZ_LN854573:c2488862-2488500 [Pseudomonas sp. URMO17WK12:I11]
MVRGQAPQRGDVYWVDPNPVAGREMMSRHRFVVITPREINALGVSMTVPITSGGSFSRNSGLAVVVSGHDTTGVAVCNQV
RSFDIEQRVRDGSAKFIERLDDVTMADIVARVVSSIDPLD
MVRGQAPQRGDVYWVDPNPVAGREMMSRHRFVVITPREINALGVSMTVPITSGGSFSRNSGLAVVVSGHDTTGVAVCNQV
RSFDIEQRVRDGSAKFIERLDDVTMADIVARVVSSIDPLD
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S4HTM0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S4HTP8 |