Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2103673..2104202 | Replicon | chromosome |
Accession | NZ_LN854556 | ||
Organism | Staphylococcus aureus strain B155 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | SABB155_RS10575 | Protein ID | WP_000621175.1 |
Coordinates | 2103673..2104035 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | SABB155_RS10580 | Protein ID | WP_000948331.1 |
Coordinates | 2104032..2104202 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SABB155_RS10550 | 2100651..2101421 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
SABB155_RS10555 | 2101396..2101875 | - | 480 | WP_054190427.1 | anti-sigma B factor RsbW | - |
SABB155_RS10560 | 2101877..2102203 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
SABB155_RS10565 | 2102322..2103323 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
SABB155_RS10575 | 2103673..2104035 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
SABB155_RS10580 | 2104032..2104202 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
SABB155_RS10585 | 2104287..2105435 | - | 1149 | WP_054190429.1 | alanine racemase | - |
SABB155_RS10590 | 2105501..2105860 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
SABB155_RS10595 | 2105864..2106355 | - | 492 | WP_054190430.1 | PH domain-containing protein | - |
SABB155_RS10600 | 2106342..2107925 | - | 1584 | WP_054190431.1 | PH domain-containing protein | - |
SABB155_RS10605 | 2107918..2108397 | - | 480 | WP_054190432.1 | hypothetical protein | - |
SABB155_RS10610 | 2108606..2109166 | - | 561 | WP_054190433.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T285702 WP_000621175.1 NZ_LN854556:c2104035-2103673 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|