Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1907223..1907996 | Replicon | chromosome |
| Accession | NZ_LN854556 | ||
| Organism | Staphylococcus aureus strain B155 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | SABB155_RS09360 | Protein ID | WP_054189550.1 |
| Coordinates | 1907223..1907372 (-) | Length | 50 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | A0A0D1IYN8 |
| Locus tag | SABB155_RS09365 | Protein ID | WP_001251219.1 |
| Coordinates | 1907397..1907996 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SABB155_RS09345 | 1903294..1904115 | + | 822 | WP_054189552.1 | RluA family pseudouridine synthase | - |
| SABB155_RS09350 | 1904582..1905967 | - | 1386 | WP_054189551.1 | class II fumarate hydratase | - |
| SABB155_RS09355 | 1906163..1906558 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| SABB155_RS09360 | 1907223..1907372 | - | 150 | WP_054189550.1 | hypothetical protein | Toxin |
| SABB155_RS09365 | 1907397..1907996 | - | 600 | WP_001251219.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| SABB155_RS09370 | 1908155..1908625 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| SABB155_RS09375 | 1908630..1909757 | - | 1128 | WP_054189549.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| SABB155_RS09380 | 1909908..1910630 | - | 723 | WP_054189583.1 | amino acid ABC transporter ATP-binding protein | - |
| SABB155_RS09385 | 1910623..1912080 | - | 1458 | WP_054189548.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5862.20 Da Isoelectric Point: 3.9075
>T285701 WP_054189550.1 NZ_LN854556:c1907372-1907223 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVNDFEDLKELGKEMEQISDQNEQEKNSEEDN
MSKDKDPKLNYHEEENSMVNDFEDLKELGKEMEQISDQNEQEKNSEEDN
Download Length: 150 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22357.50 Da Isoelectric Point: 5.1445
>AT285701 WP_001251219.1 NZ_LN854556:c1907996-1907397 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNIEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNIEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|