Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 1525407..1526195 Replicon chromosome
Accession NZ_LN854556
Organism Staphylococcus aureus strain B155

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag SABB155_RS07425 Protein ID WP_000525004.1
Coordinates 1525734..1526195 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag SABB155_RS07420 Protein ID WP_000333630.1
Coordinates 1525407..1525721 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SABB155_RS07360 1520549..1521715 - 1167 WP_000762547.1 DUF2800 domain-containing protein -
SABB155_RS07365 1521712..1522074 - 363 WP_000985984.1 hypothetical protein -
SABB155_RS07370 1522089..1522412 - 324 WP_000175001.1 hypothetical protein -
SABB155_RS07375 1522491..1522652 - 162 WP_001285954.1 DUF1270 domain-containing protein -
SABB155_RS07380 1522665..1522928 - 264 WP_001124160.1 helix-turn-helix domain-containing protein -
SABB155_RS07385 1522953..1523168 - 216 WP_001097552.1 hypothetical protein -
SABB155_RS07390 1523223..1523588 + 366 WP_001128433.1 hypothetical protein -
SABB155_RS07395 1523557..1523802 - 246 WP_001025401.1 DUF2829 domain-containing protein -
SABB155_RS07400 1523858..1524067 + 210 WP_000642492.1 hypothetical protein -
SABB155_RS07405 1524057..1524200 - 144 WP_000939498.1 hypothetical protein -
SABB155_RS07410 1524229..1525005 - 777 WP_001148544.1 Rha family transcriptional regulator -
SABB155_RS07415 1525019..1525255 - 237 WP_001121027.1 helix-turn-helix domain-containing protein -
SABB155_RS07420 1525407..1525721 + 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
SABB155_RS07425 1525734..1526195 + 462 WP_000525004.1 hypothetical protein Toxin
SABB155_RS07430 1526213..1526647 + 435 WP_000755718.1 hypothetical protein -
SABB155_RS07435 1526676..1527071 + 396 WP_000449655.1 hypothetical protein -
SABB155_RS07440 1527161..1527307 + 147 WP_001795334.1 hypothetical protein -
SABB155_RS07445 1527304..1527918 - 615 WP_000191466.1 hypothetical protein -
SABB155_RS07450 1528044..1529249 + 1206 WP_000264751.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukF-PV / lukS-PV 1482606..1542007 59401


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T285699 WP_000525004.1 NZ_LN854556:1525734-1526195 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT285699 WP_000333630.1 NZ_LN854556:1525407-1525721 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References