Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-PHD
Location 5231621..5232291 Replicon chromosome
Accession NZ_LN850107
Organism Alloactinosynnema sp. L-07 isolate Alloactinosynnema sp. L-07

Toxin (Protein)


Gene name vapC Uniprot ID A0A0H5CQJ9
Locus tag BN1701_RS23485 Protein ID WP_054052259.1
Coordinates 5231621..5232022 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A0H5D5Y2
Locus tag BN1701_RS23490 Protein ID WP_054052261.1
Coordinates 5232019..5232291 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN1701_RS23465 5226836..5228029 - 1194 WP_054052254.1 elongation factor Tu -
BN1701_RS23470 5228129..5230228 - 2100 WP_054052256.1 elongation factor G -
BN1701_RS23475 5230298..5230768 - 471 WP_018682836.1 30S ribosomal protein S7 -
BN1701_RS23480 5230770..5231144 - 375 WP_030473471.1 30S ribosomal protein S12 -
BN1701_RS23485 5231621..5232022 - 402 WP_054052259.1 type II toxin-antitoxin system VapC family toxin Toxin
BN1701_RS23490 5232019..5232291 - 273 WP_054052261.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
BN1701_RS23495 5232497..5233066 + 570 WP_054052263.1 hypothetical protein -
BN1701_RS23500 5233091..5233492 - 402 WP_054052265.1 hypothetical protein -
BN1701_RS23505 5233489..5234361 - 873 WP_054052267.1 hypothetical protein -
BN1701_RS23510 5234358..5234711 - 354 WP_054052269.1 hypothetical protein -
BN1701_RS23515 5234791..5235063 - 273 WP_054052270.1 DUF2277 domain-containing protein -
BN1701_RS23520 5235152..5235742 + 591 WP_054052272.1 TetR/AcrR family transcriptional regulator -
BN1701_RS23525 5235805..5236533 + 729 WP_054052274.1 SDR family oxidoreductase -
BN1701_RS23530 5236533..5236730 + 198 WP_054052276.1 4-oxalocrotonate tautomerase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - tufA 5214362..5232291 17929


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14178.35 Da        Isoelectric Point: 5.8855

>T285690 WP_054052259.1 NZ_LN850107:c5232022-5231621 [Alloactinosynnema sp. L-07]
VIYLDSCAIVKLVIPEAESRALNVWLAERPDDRLVTSKLSEVEVTRAVRRSRPGVLGGVSTVLRYLGRLEIGDAVRATAA
AYLDPNLRTLDAIHLATAQSLELAGGPLSAFVTYDKRLAAAAEEVGLPVVAPS

Download         Length: 402 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9562.80 Da        Isoelectric Point: 4.2702

>AT285690 WP_054052261.1 NZ_LN850107:c5232291-5232019 [Alloactinosynnema sp. L-07]
VEQIPISQLNQDTAGALARVANGESLEVTNRGRVVARLVPPADDAYSRLVATGLLAPATLRGPIPMPEGEIDETGAASAA
LIQMREEERW

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H5CQJ9

Antitoxin

Source ID Structure
AlphaFold DB A0A0H5D5Y2

References