Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 1296812..1297364 Replicon chromosome
Accession NZ_LN850107
Organism Alloactinosynnema sp. L-07 isolate Alloactinosynnema sp. L-07

Toxin (Protein)


Gene name mazF Uniprot ID A0A0H5CGB9
Locus tag BN1701_RS06245 Protein ID WP_054046350.1
Coordinates 1297017..1297364 (+) Length 116 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A0H5CF61
Locus tag BN1701_RS06240 Protein ID WP_054046347.1
Coordinates 1296812..1297030 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN1701_RS06210 1292242..1292904 + 663 WP_054055663.1 ribulose-phosphate 3-epimerase -
BN1701_RS06215 1292941..1293936 + 996 WP_054046336.1 bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD -
BN1701_RS06220 1293947..1294582 + 636 WP_054046338.1 riboflavin synthase -
BN1701_RS06225 1294575..1295861 + 1287 WP_054046341.1 bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II -
BN1701_RS06230 1295858..1296355 + 498 WP_054046343.1 6,7-dimethyl-8-ribityllumazine synthase -
BN1701_RS06235 1296331..1296789 + 459 WP_054046345.1 PH domain-containing protein -
BN1701_RS06240 1296812..1297030 + 219 WP_054046347.1 antitoxin Antitoxin
BN1701_RS06245 1297017..1297364 + 348 WP_054046350.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
BN1701_RS06250 1297505..1297924 + 420 WP_054055664.1 Rieske (2Fe-2S) protein -
BN1701_RS06255 1298136..1298654 - 519 WP_082859679.1 esterase-like activity of phytase family protein -
BN1701_RS06260 1298995..1299612 - 618 WP_054046352.1 class I SAM-dependent methyltransferase -
BN1701_RS06265 1299678..1301606 + 1929 WP_082860281.1 excinuclease ABC subunit UvrC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 116 a.a.        Molecular weight: 12286.20 Da        Isoelectric Point: 11.2832

>T285689 WP_054046350.1 NZ_LN850107:1297017-1297364 [Alloactinosynnema sp. L-07]
MRRGDIHLVDLDPARGSEANKTRPAVIVSNDAANAVAARTGRGVVTVVPITSNTGRVFPFQVLLPVACGLDLESKAQAEQ
VRSVATTRIRGRIGKVPPELLARLDEALRIHLSLS

Download         Length: 348 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 7931.68 Da        Isoelectric Point: 3.9251

>AT285689 WP_054046347.1 NZ_LN850107:1296812-1297030 [Alloactinosynnema sp. L-07]
VKLSVSLPEDDVRFIDEYSARAEVASRSSVIQLAIARLRESELQDEYAAAFAEWDAAEDAALWDVTAADASR

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H5CGB9

Antitoxin

Source ID Structure
AlphaFold DB A0A0H5CF61

References