Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1532274..1532942 | Replicon | chromosome |
Accession | NZ_LN847353 | ||
Organism | Streptococcus pneumoniae strain A66 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0B7M7X4 |
Locus tag | A66_RS07945 | Protein ID | WP_001132284.1 |
Coordinates | 1532763..1532942 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | A66_RS07940 | Protein ID | WP_000961810.1 |
Coordinates | 1532274..1532726 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A66_RS07915 | 1528164..1528907 | - | 744 | WP_001188205.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
A66_RS07920 | 1528909..1529859 | - | 951 | WP_050212241.1 | 50S ribosomal protein L11 methyltransferase | - |
A66_RS07925 | 1529997..1530425 | - | 429 | WP_053039728.1 | NUDIX hydrolase | - |
A66_RS07930 | 1530427..1531494 | - | 1068 | WP_053039729.1 | M50 family metallopeptidase | - |
A66_RS07935 | 1531513..1531983 | - | 471 | WP_000257104.1 | DUF3013 family protein | - |
A66_RS07940 | 1532274..1532726 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
A66_RS07945 | 1532763..1532942 | - | 180 | WP_001132284.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
A66_RS07950 | 1533079..1533258 | - | 180 | WP_001048906.1 | hypothetical protein | - |
A66_RS07955 | 1533423..1533662 | - | 240 | Protein_1540 | hypothetical protein | - |
A66_RS07960 | 1533932..1535203 | + | 1272 | WP_001113214.1 | replication-associated recombination protein A | - |
A66_RS07970 | 1535748..1537067 | - | 1320 | WP_000502562.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.95 Da Isoelectric Point: 11.0174
>T285686 WP_001132284.1 NZ_LN847353:c1532942-1532763 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT285686 WP_000961810.1 NZ_LN847353:c1532726-1532274 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B7M7X4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0IC64 |