Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 3599533..3600052 | Replicon | chromosome |
| Accession | NZ_LN847264 | ||
| Organism | Pseudomonas sp. CCOS 191 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0F7Y3G5 |
| Locus tag | CCOS191_RS15865 | Protein ID | WP_046856044.1 |
| Coordinates | 3599533..3599817 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0F7XZJ5 |
| Locus tag | CCOS191_RS15870 | Protein ID | WP_046857823.1 |
| Coordinates | 3599807..3600052 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CCOS191_RS15845 | 3594824..3595861 | - | 1038 | WP_046856040.1 | histone deacetylase family protein | - |
| CCOS191_RS15850 | 3595861..3597102 | - | 1242 | WP_046856041.1 | Zn-dependent hydrolase | - |
| CCOS191_RS15855 | 3597119..3598423 | - | 1305 | WP_046856042.1 | MHS family MFS transporter | - |
| CCOS191_RS15860 | 3598607..3599524 | + | 918 | WP_046856043.1 | LysR family transcriptional regulator | - |
| CCOS191_RS15865 | 3599533..3599817 | - | 285 | WP_046856044.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CCOS191_RS15870 | 3599807..3600052 | - | 246 | WP_046857823.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| CCOS191_RS15875 | 3600132..3600872 | - | 741 | WP_046856045.1 | hypothetical protein | - |
| CCOS191_RS15880 | 3601237..3604632 | + | 3396 | WP_046856046.1 | multicopper oxidase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3586039..3627953 | 41914 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10936.83 Da Isoelectric Point: 10.9886
>T285683 WP_046856044.1 NZ_LN847264:c3599817-3599533 [Pseudomonas sp. CCOS 191]
MTYKLEFLPSALKEWKKLGHTVREQARRKLKERLLSPRVGADAMRDLPDHFKIKLKASGYRVVYRVEDDRVVVVVVAIGK
RERGQAYRSAADRL
MTYKLEFLPSALKEWKKLGHTVREQARRKLKERLLSPRVGADAMRDLPDHFKIKLKASGYRVVYRVEDDRVVVVVVAIGK
RERGQAYRSAADRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F7Y3G5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F7XZJ5 |