Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 326357..326962 | Replicon | chromosome |
Accession | NZ_LN847264 | ||
Organism | Pseudomonas sp. CCOS 191 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A0F7Y1Z8 |
Locus tag | CCOS191_RS01580 | Protein ID | WP_046853797.1 |
Coordinates | 326357..326647 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | CCOS191_RS01585 | Protein ID | WP_046853798.1 |
Coordinates | 326657..326962 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCOS191_RS01560 | 321797..322570 | - | 774 | WP_046853793.1 | ABC transporter ATP-binding protein | - |
CCOS191_RS01565 | 323177..324562 | + | 1386 | WP_046853794.1 | GABA permease | - |
CCOS191_RS01570 | 324649..325092 | - | 444 | WP_046853795.1 | hypothetical protein | - |
CCOS191_RS01575 | 325182..326063 | - | 882 | WP_172670913.1 | polyphosphate kinase 2 | - |
CCOS191_RS01580 | 326357..326647 | + | 291 | WP_046853797.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CCOS191_RS01585 | 326657..326962 | + | 306 | WP_046853798.1 | putative addiction module antidote protein | Antitoxin |
CCOS191_RS01595 | 327242..327514 | - | 273 | WP_011536185.1 | oxidative damage protection protein | - |
CCOS191_RS01600 | 327511..328578 | - | 1068 | WP_046853799.1 | A/G-specific adenine glycosylase | - |
CCOS191_RS01605 | 328575..330824 | - | 2250 | WP_046853800.1 | AsmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 307248..333744 | 26496 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10898.73 Da Isoelectric Point: 10.5526
>T285681 WP_046853797.1 NZ_LN847264:326357-326647 [Pseudomonas sp. CCOS 191]
MHTLIQTDRYKKWFAALRDARAQARINVRLRRVELGVLGDCKPVGEGVLELRVDYGPGYRVYLARRGYEVILLLAGGDKT
TQARDIKSALKLARDI
MHTLIQTDRYKKWFAALRDARAQARINVRLRRVELGVLGDCKPVGEGVLELRVDYGPGYRVYLARRGYEVILLLAGGDKT
TQARDIKSALKLARDI
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|