Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 1989002..1989762 | Replicon | chromosome |
| Accession | NZ_LN832559 | ||
| Organism | Paracoccus aminovorans isolate JCM7685 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A1I3FM65 |
| Locus tag | JCM7685_RS09895 | Protein ID | WP_074971306.1 |
| Coordinates | 1989232..1989762 (+) | Length | 177 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | JCM7685_RS09890 | Protein ID | WP_197701048.1 |
| Coordinates | 1989002..1989244 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JCM7685_RS20045 | 1987260..1987388 | - | 129 | Protein_1966 | IS3 family transposase | - |
| JCM7685_RS09885 | 1987456..1988388 | + | 933 | WP_100526019.1 | IS5 family transposase | - |
| JCM7685_RS09890 | 1989002..1989244 | + | 243 | WP_197701048.1 | DUF1778 domain-containing protein | Antitoxin |
| JCM7685_RS09895 | 1989232..1989762 | + | 531 | WP_074971306.1 | GNAT family N-acetyltransferase | Toxin |
| JCM7685_RS09900 | 1990465..1991193 | - | 729 | WP_028030902.1 | IS21-like element helper ATPase IstB | - |
| JCM7685_RS09905 | 1991193..1992692 | - | 1500 | WP_090271472.1 | IS21 family transposase | - |
| JCM7685_RS09910 | 1992825..1993013 | + | 189 | Protein_1972 | DUF4102 domain-containing protein | - |
| JCM7685_RS09915 | 1993034..1994011 | - | 978 | Protein_1973 | IS66 family transposase | - |
| JCM7685_RS09920 | 1994052..1994465 | - | 414 | Protein_1974 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1979495..1995018 | 15523 | |
| - | inside | IScluster/Tn | - | - | 1987456..1994414 | 6958 | |
| - | inside | Prophage | - | - | 1977387..1995018 | 17631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 19028.73 Da Isoelectric Point: 5.6523
>T285678 WP_074971306.1 NZ_LN832559:1989232-1989762 [Paracoccus aminovorans]
MAEIVDTPDHPELPLSAPVPLTAEHDLSAFDCGEPALNDWLRHRALKNESRFSRTYVVCAGNRVVGYFCISAGSVERNAA
PGKVRRNAPDLIPVSIIGRLAVSLDHAGKGLGADLLSDALRRIAVASQSIGIGAVLVQAKDEAAKRFYLRCAEFIEYPED
SRTLFLPIETVVAGFD
MAEIVDTPDHPELPLSAPVPLTAEHDLSAFDCGEPALNDWLRHRALKNESRFSRTYVVCAGNRVVGYFCISAGSVERNAA
PGKVRRNAPDLIPVSIIGRLAVSLDHAGKGLGADLLSDALRRIAVASQSIGIGAVLVQAKDEAAKRFYLRCAEFIEYPED
SRTLFLPIETVVAGFD
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|