Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1512940..1513578 | Replicon | chromosome |
| Accession | NZ_LN832404 | ||
| Organism | Escherichia coli K-12 substr. AG100 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | EK12AG100_RS07595 | Protein ID | WP_000813794.1 |
| Coordinates | 1512940..1513116 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EK12AG100_RS07600 | Protein ID | WP_001270286.1 |
| Coordinates | 1513162..1513578 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EK12AG100_RS07575 | 1508559..1509773 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
| EK12AG100_RS07580 | 1509826..1510362 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| EK12AG100_RS07585 | 1510435..1512396 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EK12AG100_RS07590 | 1512488..1512718 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| EK12AG100_RS07595 | 1512940..1513116 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EK12AG100_RS07600 | 1513162..1513578 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EK12AG100_RS07605 | 1513657..1515063 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| EK12AG100_RS07610 | 1515308..1516453 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| EK12AG100_RS07615 | 1516471..1517484 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| EK12AG100_RS07620 | 1517485..1518426 | + | 942 | WP_046608200.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T285656 WP_000813794.1 NZ_LN832404:1512940-1513116 [Escherichia coli K-12]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT285656 WP_001270286.1 NZ_LN832404:1513162-1513578 [Escherichia coli K-12]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|