Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 479389..480007 | Replicon | chromosome |
Accession | NZ_LN832404 | ||
Organism | Escherichia coli K-12 substr. AG100 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | EK12AG100_RS02370 | Protein ID | WP_001291435.1 |
Coordinates | 479389..479607 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | EK12AG100_RS02375 | Protein ID | WP_000344800.1 |
Coordinates | 479633..480007 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EK12AG100_RS02340 | 474678..475250 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
EK12AG100_RS02345 | 475281..475592 | - | 312 | WP_000409911.1 | MGMT family protein | - |
EK12AG100_RS02350 | 475971..476324 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
EK12AG100_RS02355 | 476366..477916 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
EK12AG100_RS02360 | 478080..478550 | - | 471 | WP_000136192.1 | YlaC family protein | - |
EK12AG100_RS02365 | 478666..479217 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
EK12AG100_RS02370 | 479389..479607 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
EK12AG100_RS02375 | 479633..480007 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
EK12AG100_RS02380 | 480553..483702 | - | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
EK12AG100_RS02385 | 483725..484918 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T285651 WP_001291435.1 NZ_LN832404:c479607-479389 [Escherichia coli K-12]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT285651 WP_000344800.1 NZ_LN832404:c480007-479633 [Escherichia coli K-12]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |