Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1568389..1568994 | Replicon | chromosome |
Accession | NZ_LN831776 | ||
Organism | Paenibacillus riograndensis SBR5 isolate SBR5(T) |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0E4H7G2 |
Locus tag | PRIO_RS06820 | Protein ID | WP_019913013.1 |
Coordinates | 1568644..1568994 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PRIO_RS06815 | Protein ID | WP_174469047.1 |
Coordinates | 1568389..1568640 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRIO_RS06805 | 1565655..1566740 | + | 1086 | WP_020427628.1 | outer membrane lipoprotein carrier protein LolA | - |
PRIO_RS06810 | 1566964..1568145 | + | 1182 | WP_020427627.1 | alanine racemase | - |
PRIO_RS06815 | 1568389..1568640 | + | 252 | WP_174469047.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PRIO_RS06820 | 1568644..1568994 | + | 351 | WP_019913013.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PRIO_RS06825 | 1569407..1570711 | + | 1305 | WP_039787242.1 | extracellular solute-binding protein | - |
PRIO_RS06830 | 1570819..1571703 | + | 885 | WP_020427624.1 | sugar ABC transporter permease | - |
PRIO_RS06835 | 1571706..1572533 | + | 828 | WP_020427623.1 | carbohydrate ABC transporter permease | - |
PRIO_RS06840 | 1572567..1573385 | + | 819 | WP_020427622.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12749.67 Da Isoelectric Point: 4.8265
>T285646 WP_019913013.1 NZ_LN831776:1568644-1568994 [Paenibacillus riograndensis SBR5]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQV
RTIDKQRLTDKITHLDDETMKLVDDSLQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQV
RTIDKQRLTDKITHLDDETMKLVDDSLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|