Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 970428..970993 | Replicon | chromosome |
Accession | NZ_LN831776 | ||
Organism | Paenibacillus riograndensis SBR5 isolate SBR5(T) |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0E4CUN9 |
Locus tag | PRIO_RS04215 | Protein ID | WP_020426982.1 |
Coordinates | 970652..970993 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PRIO_RS04210 | Protein ID | WP_020426981.1 |
Coordinates | 970428..970658 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRIO_RS04205 | 969242..970231 | + | 990 | WP_046501200.1 | tRNA-dihydrouridine synthase | - |
PRIO_RS04210 | 970428..970658 | + | 231 | WP_020426981.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PRIO_RS04215 | 970652..970993 | + | 342 | WP_020426982.1 | endoribonuclease MazF | Toxin |
PRIO_RS04220 | 971322..971888 | + | 567 | WP_020426983.1 | hypothetical protein | - |
PRIO_RS04225 | 972026..973036 | + | 1011 | WP_020426984.1 | sugar-binding protein | - |
PRIO_RS04230 | 973243..975090 | + | 1848 | WP_020426985.1 | sensor histidine kinase | - |
PRIO_RS04235 | 975087..975941 | + | 855 | WP_020426986.1 | response regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 925550..1009221 | 83671 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12482.58 Da Isoelectric Point: 7.8216
>T285645 WP_020426982.1 NZ_LN831776:970652-970993 [Paenibacillus riograndensis SBR5]
MVTGGYVPDRGDLIWLQFNPQAGHEQAGKRPALVVSPASYNRKVGLSLLCPVTSKQKDYPFEVVIPQDLPIEGVILADQV
KSLDWQSRQAAFICKVPQIILSDVVAKLDLLIR
MVTGGYVPDRGDLIWLQFNPQAGHEQAGKRPALVVSPASYNRKVGLSLLCPVTSKQKDYPFEVVIPQDLPIEGVILADQV
KSLDWQSRQAAFICKVPQIILSDVVAKLDLLIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|