Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 953076..953738 | Replicon | chromosome |
Accession | NZ_LN831051 | ||
Organism | Streptococcus pneumoniae strain NCTC7465 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | AT689_RS05170 | Protein ID | WP_000192221.1 |
Coordinates | 953076..953249 (+) | Length | 58 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | AT689_RS05175 | Protein ID | WP_000961810.1 |
Coordinates | 953286..953738 (+) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT689_RS05145 | 949051..950370 | + | 1320 | WP_000502561.1 | glycoside hydrolase family 32 protein | - |
AT689_RS05155 | 950915..952186 | - | 1272 | WP_001113225.1 | replication-associated recombination protein A | - |
AT689_RS05160 | 952456..952695 | + | 240 | WP_000818079.1 | hypothetical protein | - |
AT689_RS05165 | 952685..952933 | + | 249 | WP_000797237.1 | hypothetical protein | - |
AT689_RS05170 | 953076..953249 | + | 174 | WP_000192221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
AT689_RS05175 | 953286..953738 | + | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
AT689_RS05180 | 954029..954499 | + | 471 | WP_000257100.1 | DUF3013 family protein | - |
AT689_RS05185 | 954518..955606 | + | 1089 | WP_000719704.1 | M50 family metallopeptidase | - |
AT689_RS05190 | 955587..955745 | + | 159 | WP_000418159.1 | 7,8-dihydro-8-oxoguanine-triphosphatase | - |
AT689_RS05195 | 955855..956889 | + | 1035 | WP_000747916.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6368.47 Da Isoelectric Point: 10.8214
>T285641 WP_000192221.1 NZ_LN831051:953076-953249 [Streptococcus pneumoniae]
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQAGL
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQAGL
Download Length: 174 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT285641 WP_000961810.1 NZ_LN831051:953286-953738 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|