Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 5732017..5732658 | Replicon | chromosome |
Accession | NZ_LN831039 | ||
Organism | Mycolicibacterium smegmatis strain NCTC8159 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | AT701_RS27580 | Protein ID | WP_011730672.1 |
Coordinates | 5732017..5732460 (-) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | A0A2U9PXD6 |
Locus tag | AT701_RS27585 | Protein ID | WP_003897042.1 |
Coordinates | 5732470..5732658 (-) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT701_RS27560 | 5727498..5728235 | + | 738 | WP_011730668.1 | GntR family transcriptional regulator | - |
AT701_RS27565 | 5728237..5729769 | + | 1533 | WP_058126982.1 | cyclohexanecarboxylate-CoA ligase | - |
AT701_RS27570 | 5729770..5730543 | + | 774 | WP_011730670.1 | SDR family oxidoreductase | - |
AT701_RS27575 | 5730540..5732012 | + | 1473 | WP_058127741.1 | long-chain fatty acid--CoA ligase | - |
AT701_RS27580 | 5732017..5732460 | - | 444 | WP_011730672.1 | SRPBCC family protein | Toxin |
AT701_RS27585 | 5732470..5732658 | - | 189 | WP_003897042.1 | antitoxin | Antitoxin |
AT701_RS27590 | 5732684..5735059 | - | 2376 | WP_058126983.1 | cation-translocating P-type ATPase | - |
AT701_RS27595 | 5735073..5736680 | - | 1608 | WP_162267879.1 | serine hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16157.75 Da Isoelectric Point: 9.9432
>T285640 WP_011730672.1 NZ_LN831039:c5732460-5732017 [Mycolicibacterium smegmatis]
MAKLSVSVEVPLPPEQAWEYASDLSRYHEWLSIHRAWRSKLPETLEKGTVIESIVEVKGMLNRVRWTLVHYKPPQALTLN
GDGRGGVKVKLIGKIKPTDNGATVGFDLHLGGPALFGPIGMVVAAALKSDIQESLNRFKQLYAPSAT
MAKLSVSVEVPLPPEQAWEYASDLSRYHEWLSIHRAWRSKLPETLEKGTVIESIVEVKGMLNRVRWTLVHYKPPQALTLN
GDGRGGVKVKLIGKIKPTDNGATVGFDLHLGGPALFGPIGMVVAAALKSDIQESLNRFKQLYAPSAT
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|