Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 4528956..4529497 | Replicon | chromosome |
Accession | NZ_LN831039 | ||
Organism | Mycolicibacterium smegmatis strain NCTC8159 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2U9PVI3 |
Locus tag | AT701_RS21725 | Protein ID | WP_003895797.1 |
Coordinates | 4529168..4529497 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0R0N3 |
Locus tag | AT701_RS21720 | Protein ID | WP_011729843.1 |
Coordinates | 4528956..4529165 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT701_RS21695 | 4524227..4524997 | - | 771 | WP_011729837.1 | SDR family oxidoreductase | - |
AT701_RS21700 | 4525027..4525935 | - | 909 | WP_011729838.1 | cupin domain-containing protein | - |
AT701_RS21705 | 4525965..4526885 | - | 921 | WP_011729840.1 | NADP-dependent oxidoreductase | - |
AT701_RS21710 | 4526975..4527166 | - | 192 | Protein_4249 | hypothetical protein | - |
AT701_RS21715 | 4527383..4528795 | + | 1413 | Protein_4250 | dihydrolipoyl dehydrogenase | - |
AT701_RS21720 | 4528956..4529165 | + | 210 | WP_011729843.1 | antitoxin MazE family protein | Antitoxin |
AT701_RS21725 | 4529168..4529497 | + | 330 | WP_003895797.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
AT701_RS21730 | 4529540..4530103 | - | 564 | WP_014878038.1 | TetR/AcrR family transcriptional regulator | - |
AT701_RS21735 | 4530209..4531144 | + | 936 | WP_003895799.1 | alpha/beta fold hydrolase | - |
AT701_RS21740 | 4531141..4532853 | + | 1713 | WP_058126565.1 | NAD(P)/FAD-dependent oxidoreductase | - |
AT701_RS21750 | 4533070..4533450 | + | 381 | WP_174519608.1 | phage holin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11739.52 Da Isoelectric Point: 10.4023
>T285639 WP_003895797.1 NZ_LN831039:4529168-4529497 [Mycolicibacterium smegmatis]
VRRGDIYTAAARGAYTGKPRPVLIIQDDRFDATASVTVVPFTTSDTDAPLLRIRIEPTPATGLSTVSSLMIDKVTTVPRS
SLTHRVGRLAETDMVRTDRALLVFLGIAG
VRRGDIYTAAARGAYTGKPRPVLIIQDDRFDATASVTVVPFTTSDTDAPLLRIRIEPTPATGLSTVSSLMIDKVTTVPRS
SLTHRVGRLAETDMVRTDRALLVFLGIAG
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2U9PVI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0R0N3 |