Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pezAT/zeta-ParD |
Location | 3569300..3570296 | Replicon | chromosome |
Accession | NZ_LN831039 | ||
Organism | Mycolicibacterium smegmatis strain NCTC8159 |
Toxin (Protein)
Gene name | pezT | Uniprot ID | - |
Locus tag | AT701_RS17180 | Protein ID | WP_058126279.1 |
Coordinates | 3569718..3570296 (+) | Length | 193 a.a. |
Antitoxin (Protein)
Gene name | pezA | Uniprot ID | I7GB97 |
Locus tag | AT701_RS17175 | Protein ID | WP_003894879.1 |
Coordinates | 3569300..3569692 (+) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT701_RS17155 | 3564770..3565888 | + | 1119 | WP_003894875.1 | acyltransferase | - |
AT701_RS17160 | 3566062..3566667 | + | 606 | WP_003894876.1 | class I SAM-dependent methyltransferase | - |
AT701_RS17165 | 3566669..3568297 | - | 1629 | WP_058126278.1 | GMC family oxidoreductase N-terminal domain-containing protein | - |
AT701_RS17170 | 3568607..3569236 | + | 630 | WP_003894878.1 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
AT701_RS17175 | 3569300..3569692 | + | 393 | WP_003894879.1 | hypothetical protein | Antitoxin |
AT701_RS17180 | 3569718..3570296 | + | 579 | WP_058126279.1 | zeta toxin family protein | Toxin |
AT701_RS17185 | 3570308..3571660 | - | 1353 | WP_011729067.1 | LysM peptidoglycan-binding domain-containing protein | - |
AT701_RS35265 | 3571995..3572150 | + | 156 | WP_003894882.1 | hypothetical protein | - |
AT701_RS17195 | 3572356..3573744 | + | 1389 | WP_058126280.1 | L-serine ammonia-lyase | - |
AT701_RS17200 | 3573778..3574338 | - | 561 | WP_058126281.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 193 a.a. Molecular weight: 21118.31 Da Isoelectric Point: 9.9425
>T285638 WP_058126279.1 NZ_LN831039:3569718-3570296 [Mycolicibacterium smegmatis]
VKRLDLVVGPNGAGKSTFVELTLAPLLTGSAFVNADEIAKRRWPHAPAEHSYDAARIASDTRLKLIELGESFIAETVFSH
PSKLQLIDTAQAAGYTVVMHVVMIPEDLAVLRVQHRVRAGGHHVPEEKIRERHQRLWPLVALAAARADISTFYDNSAVRG
PRIVAQLAGGFAVGRPAWPMWAPQVLTSRWPE
VKRLDLVVGPNGAGKSTFVELTLAPLLTGSAFVNADEIAKRRWPHAPAEHSYDAARIASDTRLKLIELGESFIAETVFSH
PSKLQLIDTAQAAGYTVVMHVVMIPEDLAVLRVQHRVRAGGHHVPEEKIRERHQRLWPLVALAAARADISTFYDNSAVRG
PRIVAQLAGGFAVGRPAWPMWAPQVLTSRWPE
Download Length: 579 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13841.29 Da Isoelectric Point: 4.9246
>AT285638 WP_003894879.1 NZ_LN831039:3569300-3569692 [Mycolicibacterium smegmatis]
MTETADRVTRFAADLVESAAAEGARQSRSAKQQLDHWARVGRAVSSQHTAARRRVEAALAGDLALRDLTPEEGVVFNAEI
SAAIEENLAHTDYGQVLAGRGVTTVALDDDGAIVRYQPDGTTTVLAPAQR
MTETADRVTRFAADLVESAAAEGARQSRSAKQQLDHWARVGRAVSSQHTAARRRVEAALAGDLALRDLTPEEGVVFNAEI
SAAIEENLAHTDYGQVLAGRGVTTVALDDDGAIVRYQPDGTTTVLAPAQR
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|