Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 726775..727472 | Replicon | chromosome |
Accession | NZ_LN831039 | ||
Organism | Mycolicibacterium smegmatis strain NCTC8159 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | AT701_RS33990 | Protein ID | WP_081319354.1 |
Coordinates | 726775..727206 (-) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | AT701_RS03170 | Protein ID | WP_058125156.1 |
Coordinates | 727215..727472 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT701_RS03145 | 722798..723706 | + | 909 | WP_058125151.1 | MBL fold metallo-hydrolase | - |
AT701_RS03150 | 723699..725090 | + | 1392 | WP_058125152.1 | carboxylesterase/lipase family protein | - |
AT701_RS03155 | 725147..725779 | - | 633 | WP_058125153.1 | TetR/AcrR family transcriptional regulator | - |
AT701_RS03160 | 725858..726763 | + | 906 | WP_058125154.1 | DUF2236 domain-containing protein | - |
AT701_RS33990 | 726775..727206 | - | 432 | WP_081319354.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
AT701_RS03170 | 727215..727472 | - | 258 | WP_058125156.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
AT701_RS03175 | 727571..728473 | + | 903 | WP_058127516.1 | class I SAM-dependent methyltransferase | - |
AT701_RS03180 | 728603..730429 | + | 1827 | WP_174519565.1 | type VII secretion AAA-ATPase EccA | - |
AT701_RS03185 | 730426..731982 | + | 1557 | WP_058125158.1 | type VII secretion protein EccB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15939.08 Da Isoelectric Point: 6.1461
>T285635 WP_081319354.1 NZ_LN831039:c727206-726775 [Mycolicibacterium smegmatis]
MFLLDVNVVLAAYRADHPDHATVRPWFDRLLDGDGPFTVPVQVWASFLRLVTNRRIFPVPTPRDDAFAFIEAVNGQPHHV
PVSAGPRHLALLHQLCDEGDASGDLIPDAVLAAIAHEHHCDVATLDRDFARFTTVRHLRPSLD
MFLLDVNVVLAAYRADHPDHATVRPWFDRLLDGDGPFTVPVQVWASFLRLVTNRRIFPVPTPRDDAFAFIEAVNGQPHHV
PVSAGPRHLALLHQLCDEGDASGDLIPDAVLAAIAHEHHCDVATLDRDFARFTTVRHLRPSLD
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|