Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2121400..2121929 | Replicon | chromosome |
Accession | NZ_LN831036 | ||
Organism | Staphylococcus aureus strain NCTC13435 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | AT694_RS10740 | Protein ID | WP_000621175.1 |
Coordinates | 2121400..2121762 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | AT694_RS10745 | Protein ID | WP_000948331.1 |
Coordinates | 2121759..2121929 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT694_RS10715 | 2118378..2119148 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
AT694_RS10720 | 2119123..2119602 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
AT694_RS10725 | 2119604..2119930 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
AT694_RS10730 | 2120049..2121050 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
AT694_RS10740 | 2121400..2121762 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
AT694_RS10745 | 2121759..2121929 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
AT694_RS10750 | 2122014..2123162 | - | 1149 | WP_001281154.1 | alanine racemase | - |
AT694_RS10755 | 2123228..2123587 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
AT694_RS10760 | 2123591..2124082 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
AT694_RS10765 | 2124069..2125652 | - | 1584 | WP_001294621.1 | PH domain-containing protein | - |
AT694_RS10770 | 2125645..2126124 | - | 480 | WP_001287079.1 | hypothetical protein | - |
AT694_RS10775 | 2126333..2126893 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T285628 WP_000621175.1 NZ_LN831036:c2121762-2121400 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|