Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1925750..1926526 | Replicon | chromosome |
| Accession | NZ_LN831036 | ||
| Organism | Staphylococcus aureus strain NCTC13435 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | AT694_RS09505 | Protein ID | WP_000031108.1 |
| Coordinates | 1925750..1925902 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | AT694_RS09510 | Protein ID | WP_001251231.1 |
| Coordinates | 1925927..1926526 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT694_RS09490 | 1921476..1922297 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| AT694_RS09495 | 1922760..1924145 | - | 1386 | WP_000116231.1 | class II fumarate hydratase | - |
| AT694_RS09500 | 1924341..1924736 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| AT694_RS09505 | 1925750..1925902 | - | 153 | WP_000031108.1 | hypothetical protein | Toxin |
| AT694_RS09510 | 1925927..1926526 | - | 600 | WP_001251231.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| AT694_RS09515 | 1926686..1927156 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| AT694_RS09520 | 1927161..1928288 | - | 1128 | WP_000379986.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| AT694_RS09525 | 1928439..1929161 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| AT694_RS09530 | 1929154..1930611 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T285624 WP_000031108.1 NZ_LN831036:c1925902-1925750 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22342.49 Da Isoelectric Point: 5.3880
>AT285624 WP_001251231.1 NZ_LN831036:c1926526-1925927 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLNELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLNELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|