Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1550850..1551647 | Replicon | chromosome |
| Accession | NZ_LN831036 | ||
| Organism | Staphylococcus aureus strain NCTC13435 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A641AAS6 |
| Locus tag | AT694_RS07580 | Protein ID | WP_000525006.1 |
| Coordinates | 1551186..1551647 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | AT694_RS07575 | Protein ID | WP_001260486.1 |
| Coordinates | 1550850..1551173 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT694_RS07525 | 1546585..1547142 | - | 558 | WP_000645042.1 | DUF2815 family protein | - |
| AT694_RS07530 | 1547168..1548334 | - | 1167 | WP_000762551.1 | DUF2800 domain-containing protein | - |
| AT694_RS07535 | 1548331..1548693 | - | 363 | WP_000279446.1 | hypothetical protein | - |
| AT694_RS07540 | 1548708..1549031 | - | 324 | WP_000175000.1 | hypothetical protein | - |
| AT694_RS07545 | 1549111..1549272 | - | 162 | WP_001285955.1 | DUF1270 family protein | - |
| AT694_RS07550 | 1549285..1549548 | - | 264 | WP_001124160.1 | helix-turn-helix domain-containing protein | - |
| AT694_RS07555 | 1549573..1549788 | - | 216 | WP_001036301.1 | hypothetical protein | - |
| AT694_RS07560 | 1549843..1550208 | + | 366 | WP_001128433.1 | hypothetical protein | - |
| AT694_RS07565 | 1550177..1550422 | - | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| AT694_RS07570 | 1550438..1550686 | - | 249 | WP_000272861.1 | helix-turn-helix domain-containing protein | - |
| AT694_RS07575 | 1550850..1551173 | + | 324 | WP_001260486.1 | helix-turn-helix domain-containing protein | Antitoxin |
| AT694_RS07580 | 1551186..1551647 | + | 462 | WP_000525006.1 | hypothetical protein | Toxin |
| AT694_RS07585 | 1551664..1552098 | + | 435 | WP_001226136.1 | hypothetical protein | - |
| AT694_RS07590 | 1552127..1552522 | + | 396 | WP_000449655.1 | hypothetical protein | - |
| AT694_RS07595 | 1552612..1552758 | + | 147 | WP_001013104.1 | hypothetical protein | - |
| AT694_RS07600 | 1552755..1553369 | - | 615 | WP_000191459.1 | hypothetical protein | - |
| AT694_RS14570 | 1553495..1554701 | + | 1207 | Protein_1455 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukF-PV / lukS-PV | 1506153..1572344 | 66191 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18118.47 Da Isoelectric Point: 4.6915
>T285623 WP_000525006.1 NZ_LN831036:1551186-1551647 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVYRYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVYRYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|