Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1653374..1653963 | Replicon | chromosome |
Accession | NZ_LN831035 | ||
Organism | Haemophilus influenzae strain NCTC8143 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | Q4QL51 |
Locus tag | AT683_RS08150 | Protein ID | WP_005653200.1 |
Coordinates | 1653715..1653963 (-) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | Q4QL50 |
Locus tag | AT683_RS08145 | Protein ID | WP_005653201.1 |
Coordinates | 1653374..1653718 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT683_RS08130 | 1648597..1649991 | - | 1395 | WP_005657016.1 | sodium-coupled multidrug efflux MATE transporter HmrM | - |
AT683_RS08135 | 1650035..1650649 | + | 615 | WP_005657019.1 | riboflavin synthase | - |
AT683_RS08140 | 1650721..1653330 | - | 2610 | WP_011272463.1 | aminopeptidase N | - |
AT683_RS08145 | 1653374..1653718 | - | 345 | WP_005653201.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
AT683_RS08150 | 1653715..1653963 | - | 249 | WP_005653200.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
AT683_RS08155 | 1654134..1654628 | + | 495 | WP_005653194.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
AT683_RS08160 | 1654698..1655786 | + | 1089 | WP_005686592.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
AT683_RS08165 | 1655926..1657116 | + | 1191 | WP_005657030.1 | aspartate/tyrosine/aromatic aminotransferase | - |
AT683_RS08170 | 1657223..1657849 | - | 627 | WP_011272462.1 | energy-coupling factor ABC transporter ATP-binding protein | - |
AT683_RS08175 | 1657851..1658483 | - | 633 | WP_011272461.1 | energy-coupling factor transporter transmembrane protein EcfT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 9425.93 Da Isoelectric Point: 10.4673
>T285619 WP_005653200.1 NZ_LN831035:c1653963-1653715 [Haemophilus influenzae]
MGRTEKLLDKLAQSKSTFNWNELVSLLAQQGYEKREMAGSRVRFYNRTLEHTILLHKPHPENYIKGGALKSVKESLKQVG
IL
MGRTEKLLDKLAQSKSTFNWNELVSLLAQQGYEKREMAGSRVRFYNRTLEHTILLHKPHPENYIKGGALKSVKESLKQVG
IL
Download Length: 249 bp
Antitoxin
Download Length: 115 a.a. Molecular weight: 13142.04 Da Isoelectric Point: 4.8151
>AT285619 WP_005653201.1 NZ_LN831035:c1653718-1653374 [Haemophilus influenzae]
MKLLNYKGYVGTIEADLENNILFGKLAYIRDLVTYEAESLSELEKEFRQSVDLYLQDCLELGKEPNKPFKGVFNVRIGEE
LHREATIIAGDRSLNAFVTEAIQEKIFREKPSLR
MKLLNYKGYVGTIEADLENNILFGKLAYIRDLVTYEAESLSELEKEFRQSVDLYLQDCLELGKEPNKPFKGVFNVRIGEE
LHREATIIAGDRSLNAFVTEAIQEKIFREKPSLR
Download Length: 345 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5M6BP03 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M1GMF9 |