Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 741712..742349 | Replicon | chromosome |
| Accession | NZ_LN831035 | ||
| Organism | Haemophilus influenzae strain NCTC8143 | ||
Toxin (Protein)
| Gene name | VapC1 | Uniprot ID | E4QWH2 |
| Locus tag | AT683_RS03755 | Protein ID | WP_005649049.1 |
| Coordinates | 741712..742116 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | VapB1 | Uniprot ID | E4QWH3 |
| Locus tag | AT683_RS03760 | Protein ID | WP_005649046.1 |
| Coordinates | 742113..742349 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT683_RS03725 | 737272..737838 | + | 567 | WP_005544066.1 | elongation factor P | - |
| AT683_RS03735 | 738189..738776 | - | 588 | WP_005654063.1 | primosomal replication protein | - |
| AT683_RS03740 | 738809..740161 | - | 1353 | WP_005694344.1 | Na+/H+ antiporter family protein | - |
| AT683_RS03745 | 740475..741164 | - | 690 | WP_011271988.1 | ribonuclease T | - |
| AT683_RS03750 | 741238..741645 | - | 408 | WP_005688980.1 | lactoylglutathione lyase | - |
| AT683_RS03755 | 741712..742116 | - | 405 | WP_005649049.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| AT683_RS03760 | 742113..742349 | - | 237 | WP_005649046.1 | antitoxin | Antitoxin |
| AT683_RS03765 | 742442..743167 | - | 726 | WP_011271987.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
| AT683_RS03770 | 743220..743738 | - | 519 | WP_005649040.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| AT683_RS03775 | 743957..745723 | + | 1767 | WP_011271986.1 | aspartate--tRNA ligase | - |
| AT683_RS03780 | 745745..746218 | + | 474 | WP_011271985.1 | dihydroneopterin triphosphate diphosphatase | - |
| AT683_RS03785 | 746230..746970 | + | 741 | WP_005649034.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15692.29 Da Isoelectric Point: 8.9777
>T285617 WP_005649049.1 NZ_LN831035:c742116-741712 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIIAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIIAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|