Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 322456..323087 | Replicon | chromosome |
| Accession | NZ_LN831035 | ||
| Organism | Haemophilus influenzae strain NCTC8143 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | AT683_RS01580 | Protein ID | WP_058222150.1 |
| Coordinates | 322456..322791 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q4QMK8 |
| Locus tag | AT683_RS01585 | Protein ID | WP_005692346.1 |
| Coordinates | 322791..323087 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT683_RS01570 | 317538..318836 | - | 1299 | WP_006995277.1 | trigger factor | - |
| AT683_RS01575 | 319205..322399 | + | 3195 | WP_154590032.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
| AT683_RS01580 | 322456..322791 | - | 336 | WP_058222150.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| AT683_RS01585 | 322791..323087 | - | 297 | WP_005692346.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| AT683_RS01590 | 323207..324061 | - | 855 | WP_058222151.1 | DUF3298 domain-containing protein | - |
| AT683_RS01595 | 324080..325939 | - | 1860 | WP_058222152.1 | selenocysteine-specific translation elongation factor | - |
| AT683_RS01600 | 325936..327321 | - | 1386 | WP_038440401.1 | L-seryl-tRNA(Sec) selenium transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13148.92 Da Isoelectric Point: 4.9104
>T285613 WP_058222150.1 NZ_LN831035:c322791-322456 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCYIQGNLVLIYQYV
IRDEFDEFDEFDEFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCYIQGNLVLIYQYV
IRDEFDEFDEFDEFDELKFSRLNTHSQTALK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|