Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1681646..1682258 | Replicon | chromosome |
| Accession | NZ_LN831034 | ||
| Organism | Streptococcus pyogenes strain NCTC8198 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | J7M9F1 |
| Locus tag | B6D67_RS08925 | Protein ID | WP_010922665.1 |
| Coordinates | 1681923..1682258 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | B6D67_RS08920 | Protein ID | WP_002988079.1 |
| Coordinates | 1681646..1681933 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B6D67_RS08895 | 1676823..1677806 | - | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
| B6D67_RS08900 | 1677810..1678739 | - | 930 | WP_010922663.1 | tagatose-6-phosphate kinase | - |
| B6D67_RS08905 | 1678787..1679302 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
| B6D67_RS08910 | 1679337..1679765 | - | 429 | WP_010922664.1 | galactose-6-phosphate isomerase subunit LacA | - |
| B6D67_RS08915 | 1680212..1680985 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| B6D67_RS08920 | 1681646..1681933 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| B6D67_RS08925 | 1681923..1682258 | + | 336 | WP_010922665.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| B6D67_RS10330 | 1682410..1682880 | + | 471 | Protein_1657 | integrase | - |
| B6D67_RS08935 | 1682926..1683363 | + | 438 | WP_111713473.1 | site-specific integrase | - |
| B6D67_RS08940 | 1683483..1683875 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| B6D67_RS08945 | 1683896..1684342 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| B6D67_RS08950 | 1684560..1684766 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| B6D67_RS08955 | 1684763..1685269 | - | 507 | WP_002988070.1 | hypothetical protein | - |
| B6D67_RS08960 | 1685405..1686265 | - | 861 | WP_002982687.1 | DegV family protein | - |
| B6D67_RS08965 | 1686362..1686880 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13185.99 Da Isoelectric Point: 5.2144
>T285611 WP_010922665.1 NZ_LN831034:1681923-1682258 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | J7M9F1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |