Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1681646..1682258 Replicon chromosome
Accession NZ_LN831034
Organism Streptococcus pyogenes strain NCTC8198

Toxin (Protein)


Gene name parE Uniprot ID J7M9F1
Locus tag B6D67_RS08925 Protein ID WP_010922665.1
Coordinates 1681923..1682258 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag B6D67_RS08920 Protein ID WP_002988079.1
Coordinates 1681646..1681933 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B6D67_RS08895 1676823..1677806 - 984 WP_002982755.1 tagatose-bisphosphate aldolase -
B6D67_RS08900 1677810..1678739 - 930 WP_010922663.1 tagatose-6-phosphate kinase -
B6D67_RS08905 1678787..1679302 - 516 WP_002988082.1 galactose-6-phosphate isomerase subunit LacB -
B6D67_RS08910 1679337..1679765 - 429 WP_010922664.1 galactose-6-phosphate isomerase subunit LacA -
B6D67_RS08915 1680212..1680985 + 774 WP_002982738.1 DeoR/GlpR family DNA-binding transcription regulator -
B6D67_RS08920 1681646..1681933 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
B6D67_RS08925 1681923..1682258 + 336 WP_010922665.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
B6D67_RS10330 1682410..1682880 + 471 Protein_1657 integrase -
B6D67_RS08935 1682926..1683363 + 438 WP_111713473.1 site-specific integrase -
B6D67_RS08940 1683483..1683875 - 393 WP_002982716.1 30S ribosomal protein S9 -
B6D67_RS08945 1683896..1684342 - 447 WP_002982710.1 50S ribosomal protein L13 -
B6D67_RS08950 1684560..1684766 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
B6D67_RS08955 1684763..1685269 - 507 WP_002988070.1 hypothetical protein -
B6D67_RS08960 1685405..1686265 - 861 WP_002982687.1 DegV family protein -
B6D67_RS08965 1686362..1686880 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13185.99 Da        Isoelectric Point: 5.2144

>T285611 WP_010922665.1 NZ_LN831034:1681923-1682258 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT285611 WP_002988079.1 NZ_LN831034:1681646-1681933 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J7M9F1

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References