Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 1191136..1192178 | Replicon | chromosome |
Accession | NZ_LN831029 | ||
Organism | Achromobacter xylosoxidans strain NCTC10807 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | A0A0D6GAF2 |
Locus tag | AT699_RS05515 | Protein ID | WP_058207229.1 |
Coordinates | 1191136..1191711 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A972JB12 |
Locus tag | AT699_RS05520 | Protein ID | WP_024067903.1 |
Coordinates | 1191708..1192178 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT699_RS05485 | 1186633..1187535 | + | 903 | WP_024067896.1 | bacteriophage abortive infection AbiH family protein | - |
AT699_RS05490 | 1187577..1188302 | - | 726 | WP_024067897.1 | CBASS effector endonuclease NucC | - |
AT699_RS05495 | 1188339..1189241 | - | 903 | WP_024067898.1 | nucleotidyltransferase domain-containing protein | - |
AT699_RS05500 | 1189241..1189741 | - | 501 | WP_024067899.1 | hypothetical protein | - |
AT699_RS05505 | 1189738..1190208 | - | 471 | WP_024067900.1 | hypothetical protein | - |
AT699_RS05510 | 1190205..1191119 | - | 915 | WP_024067901.1 | AAA family ATPase | - |
AT699_RS05515 | 1191136..1191711 | - | 576 | WP_058207229.1 | PIN domain-containing protein | Toxin |
AT699_RS05520 | 1191708..1192178 | - | 471 | WP_024067903.1 | helix-turn-helix domain-containing protein | Antitoxin |
AT699_RS05525 | 1192381..1192764 | + | 384 | WP_024067904.1 | RAQPRD family integrative conjugative element protein | - |
AT699_RS05530 | 1192761..1192994 | + | 234 | WP_013520781.1 | TIGR03758 family integrating conjugative element protein | - |
AT699_RS05535 | 1193011..1193370 | + | 360 | WP_024067905.1 | TIGR03745 family integrating conjugative element membrane protein | - |
AT699_RS05540 | 1193384..1193782 | + | 399 | WP_058207559.1 | TIGR03750 family conjugal transfer protein | - |
AT699_RS05545 | 1193779..1194477 | + | 699 | WP_024067907.1 | TIGR03746 family integrating conjugative element protein | - |
AT699_RS05550 | 1194474..1195412 | + | 939 | WP_024067908.1 | TIGR03749 family integrating conjugative element protein | - |
AT699_RS05555 | 1195402..1196823 | + | 1422 | WP_024067909.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1135861..1251380 | 115519 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21576.73 Da Isoelectric Point: 5.2880
>T285608 WP_058207229.1 NZ_LN831029:c1191711-1191136 [Achromobacter xylosoxidans]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLIKRPDLNRAQVDRTSDLMDRAIPDGVVEGY
EELVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNELLAAYGIEAQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDCFLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLIKRPDLNRAQVDRTSDLMDRAIPDGVVEGY
EELVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNELLAAYGIEAQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDCFLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17225.63 Da Isoelectric Point: 6.3803
>AT285608 WP_024067903.1 NZ_LN831029:c1192178-1191708 [Achromobacter xylosoxidans]
MTTTAAQSKMTLPAAAEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHLVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTTAAQSKMTLPAAAEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHLVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|