Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 156313..156867 | Replicon | chromosome |
Accession | NZ_LN831029 | ||
Organism | Achromobacter xylosoxidans strain NCTC10807 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D6FFH4 |
Locus tag | AT699_RS00725 | Protein ID | WP_006386989.1 |
Coordinates | 156589..156867 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0D6FFH2 |
Locus tag | AT699_RS00720 | Protein ID | WP_024067400.1 |
Coordinates | 156313..156519 (+) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT699_RS00705 | 152955..153932 | - | 978 | WP_024067397.1 | tripartite tricarboxylate transporter substrate binding protein | - |
AT699_RS00710 | 154125..154775 | - | 651 | WP_024067398.1 | hypothetical protein | - |
AT699_RS00715 | 154774..156219 | + | 1446 | WP_024067399.1 | RNA polymerase factor sigma-54 | - |
AT699_RS00720 | 156313..156519 | + | 207 | WP_024067400.1 | hypothetical protein | Antitoxin |
AT699_RS00725 | 156589..156867 | + | 279 | WP_006386989.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
AT699_RS00730 | 157046..157345 | + | 300 | WP_006386990.1 | (2Fe-2S)-binding protein | - |
AT699_RS00735 | 157315..158235 | - | 921 | WP_006386991.1 | LysR family transcriptional regulator | - |
AT699_RS00740 | 158349..159263 | + | 915 | WP_024067401.1 | DMT family transporter | - |
AT699_RS00745 | 159688..160164 | + | 477 | WP_006386993.1 | bacterioferritin | - |
AT699_RS00750 | 160249..160935 | - | 687 | WP_006386994.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10370.91 Da Isoelectric Point: 9.0854
>T285606 WP_006386989.1 NZ_LN831029:156589-156867 [Achromobacter xylosoxidans]
MLDVSWLQTAADDLAGIISYIAERSPQAARDLRQRIDNAVLSLARHPCRYRAGRVSGTRECVVHPNYVVVYRVTALAIEV
VNIVHARREYPP
MLDVSWLQTAADDLAGIISYIAERSPQAARDLRQRIDNAVLSLARHPCRYRAGRVSGTRECVVHPNYVVVYRVTALAIEV
VNIVHARREYPP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D6FFH4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D6FFH2 |