Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yoeB-Axe/YoeB-RelB |
Location | 2352696..2353203 | Replicon | chromosome |
Accession | NZ_LN831027 | ||
Organism | Fusobacterium nucleatum subsp. polymorphum strain NCTC10562 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A5TSP0 |
Locus tag | AT688_RS11365 | Protein ID | WP_005895377.1 |
Coordinates | 2352696..2352956 (-) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | Axe | Uniprot ID | U7TRN8 |
Locus tag | AT688_RS11370 | Protein ID | WP_005892688.1 |
Coordinates | 2352949..2353203 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AT688_RS11335 | 2347856..2349136 | - | 1281 | WP_005895391.1 | D-alanyl-D-alanine carboxypeptidase | - |
AT688_RS11340 | 2349219..2349605 | - | 387 | WP_005895388.1 | Fe-S cluster assembly scaffold protein NifU | - |
AT688_RS11345 | 2349668..2350864 | - | 1197 | WP_005895386.1 | cysteine desulfurase NifS | - |
AT688_RS11350 | 2350943..2351593 | - | 651 | WP_005895383.1 | endonuclease III | - |
AT688_RS11355 | 2351679..2352155 | - | 477 | WP_005895381.1 | GNAT family N-acetyltransferase | - |
AT688_RS11360 | 2352183..2352686 | - | 504 | WP_005895379.1 | GNAT family N-acetyltransferase | - |
AT688_RS11365 | 2352696..2352956 | - | 261 | WP_005895377.1 | Txe/YoeB family addiction module toxin | Toxin |
AT688_RS11370 | 2352949..2353203 | - | 255 | WP_005892688.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
AT688_RS11375 | 2353496..2354704 | - | 1209 | WP_005895373.1 | tyrosine--tRNA ligase | - |
AT688_RS11380 | 2354697..2355980 | - | 1284 | WP_005895370.1 | branched-chain amino acid transport system II carrier protein | - |
AT688_RS11385 | 2355982..2356344 | - | 363 | WP_005895366.1 | arsenate reductase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10251.77 Da Isoelectric Point: 9.6749
>T285605 WP_005895377.1 NZ_LN831027:c2352956-2352696 [Fusobacterium nucleatum subsp. polymorphum]
MNNLVWTHKAWQDYLYWQTQDKKTLKKINELVKDIGRNGALNGIGKPEVLKNENAYSRRIDEKNRLVYRIVDGFIWIIAC
KGHYEE
MNNLVWTHKAWQDYLYWQTQDKKTLKKINELVKDIGRNGALNGIGKPEVLKNENAYSRRIDEKNRLVYRIVDGFIWIIAC
KGHYEE
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A5TSP0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806UAF3 |