Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 143459..143964 | Replicon | chromosome |
| Accession | NZ_LN831024 | ||
| Organism | Pseudomonas aeruginosa strain NCTC10332 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | AT700_RS00635 | Protein ID | WP_003083773.1 |
| Coordinates | 143459..143740 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | AT700_RS00640 | Protein ID | WP_003083775.1 |
| Coordinates | 143737..143964 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT700_RS00610 | 138710..140059 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| AT700_RS00615 | 140108..140794 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
| AT700_RS00620 | 140895..141629 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| AT700_RS00625 | 141833..142219 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
| AT700_RS00630 | 142251..143159 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| AT700_RS00635 | 143459..143740 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| AT700_RS00640 | 143737..143964 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| AT700_RS00645 | 144140..144760 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| AT700_RS00650 | 144861..145361 | + | 501 | WP_048520695.1 | LEA type 2 family protein | - |
| AT700_RS00655 | 145434..145775 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
| AT700_RS00660 | 145857..147284 | - | 1428 | WP_003083784.1 | GABA permease | - |
| AT700_RS00665 | 147453..148946 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T285596 WP_003083773.1 NZ_LN831024:c143740-143459 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|