Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 333057..333643 Replicon chromosome
Accession NZ_LN824140
Organism Bifidobacterium longum subsp. infantis strain CECT 7210

Toxin (Protein)


Gene name PumA Uniprot ID A0A083XX11
Locus tag BN1726_RS01480 Protein ID WP_032683781.1
Coordinates 333338..333643 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag BN1726_RS01475 Protein ID WP_007051863.1
Coordinates 333057..333341 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN1726_RS01445 328815..329180 - 366 WP_146034797.1 hypothetical protein -
BN1726_RS01450 329309..329704 - 396 WP_197704831.1 hypothetical protein -
BN1726_RS11150 329878..330168 - 291 WP_146034798.1 hypothetical protein -
BN1726_RS01455 330372..330989 - 618 WP_053083191.1 hypothetical protein -
BN1726_RS01460 330979..331671 - 693 WP_146034799.1 phosphoadenosine phosphosulfate reductase -
BN1726_RS01465 331668..332168 - 501 WP_080969817.1 bifunctional DNA primase/polymerase -
BN1726_RS01470 332423..332758 - 336 WP_077424013.1 HNH endonuclease -
BN1726_RS01475 333057..333341 - 285 WP_007051863.1 putative addiction module antidote protein Antitoxin
BN1726_RS01480 333338..333643 - 306 WP_032683781.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
BN1726_RS01485 333675..333971 - 297 WP_049137772.1 hypothetical protein -
BN1726_RS01490 334564..334752 - 189 WP_032683782.1 hypothetical protein -
BN1726_RS01495 334749..334961 - 213 WP_049136620.1 hypothetical protein -
BN1726_RS01500 334958..335221 - 264 WP_049136622.1 hypothetical protein -
BN1726_RS01505 335218..335505 - 288 WP_049136623.1 hypothetical protein -
BN1726_RS01510 335502..335744 - 243 WP_049137774.1 hypothetical protein -
BN1726_RS01515 335988..336245 - 258 WP_032684482.1 hypothetical protein -
BN1726_RS01520 336295..336540 - 246 WP_049136625.1 hypothetical protein -
BN1726_RS01525 336537..336899 - 363 WP_049136626.1 hypothetical protein -
BN1726_RS01530 336896..337144 - 249 WP_049136627.1 hypothetical protein -
BN1726_RS01535 337141..337833 - 693 Protein_297 hypothetical protein -
BN1726_RS01540 337799..338011 - 213 WP_049136629.1 hypothetical protein -
BN1726_RS01545 337995..338186 - 192 WP_032684474.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(11-94)

Antitoxin

Uncharacterized protein HI1420

(4-91)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11456.24 Da        Isoelectric Point: 10.3171

>T285593 WP_032683781.1 NZ_LN824140:c333643-333338 [Bifidobacterium longum subsp. infantis]
MEIKQTAEYRKWFKKLRNREAKAAIQARLDACKLAGRPFGDIKPVGGPVSEMRFHIGAGYRVYFTTRGNVLMLLLAGGDK
STQQTDIKQAHAILDDYKEQQ

Download         Length: 306 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10124.35 Da        Isoelectric Point: 4.3707

>AT285593 WP_007051863.1 NZ_LN824140:c333341-333057 [Bifidobacterium longum subsp. infantis]
MSTEITDYDTSEYLENEQDIIAYLNAIAEYDDPALMQAALGNVAKARGMTQIAKDAGVGRESLYKSLSKDGNPSFQTIAK
VIHALGGRLTIQAA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A083XX11

Antitoxin

Source ID Structure

References