Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 5026054..5026640 Replicon chromosome
Accession NZ_LN824133
Organism Klebsiella pneumoniae strain MS6671

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag MS6671_RS25130 Protein ID WP_002920800.1
Coordinates 5026054..5026422 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag MS6671_RS25135 Protein ID WP_004174006.1
Coordinates 5026419..5026640 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MS6671_RS25110 5021557..5022627 - 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
MS6671_RS25115 5022629..5023474 - 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
MS6671_RS25120 5023471..5024358 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
MS6671_RS25125 5024465..5025781 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
MS6671_RS25130 5026054..5026422 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
MS6671_RS25135 5026419..5026640 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
MS6671_RS25140 5026804..5027515 - 712 Protein_4829 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
MS6671_RS25145 5027517..5028250 - 734 Protein_4830 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
MS6671_RS25150 5028257..5029484 - 1228 Protein_4831 high-affinity branched-chain amino acid ABC transporter permease LivM -
MS6671_RS25155 5029549..5030473 - 925 Protein_4832 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T285586 WP_002920800.1 NZ_LN824133:c5026422-5026054 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT285586 WP_004174006.1 NZ_LN824133:c5026640-5026419 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References