Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4522605..4523262 | Replicon | chromosome |
| Accession | NZ_LN824133 | ||
| Organism | Klebsiella pneumoniae strain MS6671 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | MS6671_RS22445 | Protein ID | WP_002916310.1 |
| Coordinates | 4522605..4523015 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | MS6671_RS22450 | Protein ID | WP_002916312.1 |
| Coordinates | 4522996..4523262 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MS6671_RS22425 | 4518605..4520338 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| MS6671_RS22430 | 4520344..4521057 | - | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| MS6671_RS22435 | 4521080..4521976 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| MS6671_RS22440 | 4522077..4522598 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
| MS6671_RS22445 | 4522605..4523015 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| MS6671_RS22450 | 4522996..4523262 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| MS6671_RS22455 | 4523508..4524491 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| MS6671_RS22460 | 4524642..4525301 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
| MS6671_RS22465 | 4525465..4525776 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| MS6671_RS22470 | 4525826..4526554 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| MS6671_RS22475 | 4526673..4528106 | + | 1434 | WP_009485881.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T285584 WP_002916310.1 NZ_LN824133:c4523015-4522605 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |