Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3862635..3863278 | Replicon | chromosome |
| Accession | NZ_LN824133 | ||
| Organism | Klebsiella pneumoniae strain MS6671 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | MS6671_RS19125 | Protein ID | WP_032433387.1 |
| Coordinates | 3862635..3863051 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | MS6671_RS19130 | Protein ID | WP_001261276.1 |
| Coordinates | 3863048..3863278 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MS6671_RS19095 | 3857804..3858007 | - | 204 | WP_032433376.1 | hemolysin expression modulator Hha | - |
| MS6671_RS19100 | 3858067..3858558 | - | 492 | WP_032433378.1 | hypothetical protein | - |
| MS6671_RS19105 | 3858589..3859107 | - | 519 | WP_045326794.1 | hypothetical protein | - |
| MS6671_RS19110 | 3859166..3859414 | - | 249 | WP_032433382.1 | hypothetical protein | - |
| MS6671_RS19115 | 3859733..3861304 | + | 1572 | WP_032433383.1 | ATP-binding protein | - |
| MS6671_RS19120 | 3861499..3862479 | - | 981 | WP_032433385.1 | hypothetical protein | - |
| MS6671_RS19125 | 3862635..3863051 | - | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MS6671_RS19130 | 3863048..3863278 | - | 231 | WP_001261276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| MS6671_RS19135 | 3863583..3864398 | + | 816 | WP_032433388.1 | hypothetical protein | - |
| MS6671_RS19145 | 3864926..3867166 | - | 2241 | WP_045326788.1 | NTPase | - |
| MS6671_RS19150 | 3867169..3868256 | - | 1088 | Protein_3678 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3836081..3878642 | 42561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T285583 WP_032433387.1 NZ_LN824133:c3863051-3862635 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |