Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3845851..3846587 | Replicon | chromosome |
| Accession | NZ_LN824133 | ||
| Organism | Klebsiella pneumoniae strain MS6671 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | MS6671_RS19030 | Protein ID | WP_032433360.1 |
| Coordinates | 3845851..3846333 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | MS6671_RS19035 | Protein ID | WP_003026799.1 |
| Coordinates | 3846321..3846587 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MS6671_RS19010 | 3842400..3843140 | + | 741 | WP_050597964.1 | molecular chaperone | - |
| MS6671_RS19015 | 3843144..3843722 | + | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
| MS6671_RS19020 | 3843734..3844678 | + | 945 | WP_077254249.1 | fimbrial protein | - |
| MS6671_RS19025 | 3844891..3845490 | + | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
| MS6671_RS19030 | 3845851..3846333 | - | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| MS6671_RS19035 | 3846321..3846587 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| MS6671_RS19040 | 3846900..3847463 | - | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| MS6671_RS19045 | 3847473..3848105 | - | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| MS6671_RS19050 | 3848123..3849127 | - | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
| MS6671_RS19055 | 3849111..3849773 | - | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit L | - |
| MS6671_RS19060 | 3849802..3850941 | - | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3836081..3878642 | 42561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T285582 WP_032433360.1 NZ_LN824133:c3846333-3845851 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |