Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1305725..1306344 Replicon chromosome
Accession NZ_LN824133
Organism Klebsiella pneumoniae strain MS6671

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag MS6671_RS06485 Protein ID WP_002892050.1
Coordinates 1305725..1305943 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag MS6671_RS06490 Protein ID WP_002892066.1
Coordinates 1305970..1306344 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MS6671_RS06450 1301768..1302031 + 264 WP_032432663.1 type B 50S ribosomal protein L31 -
MS6671_RS06455 1302031..1302171 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
MS6671_RS06460 1302168..1302866 - 699 WP_023287311.1 GNAT family N-acetyltransferase -
MS6671_RS06465 1302967..1304418 + 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
MS6671_RS06470 1304393..1304863 - 471 WP_020802585.1 YlaC family protein -
MS6671_RS32140 1304884..1305024 + 141 WP_004147370.1 hypothetical protein -
MS6671_RS06480 1304996..1305562 - 567 WP_002892030.1 maltose O-acetyltransferase -
MS6671_RS06485 1305725..1305943 - 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
MS6671_RS06490 1305970..1306344 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
MS6671_RS06495 1306830..1309976 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
MS6671_RS06500 1309999..1311192 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T285576 WP_002892050.1 NZ_LN824133:c1305943-1305725 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT285576 WP_002892066.1 NZ_LN824133:c1306344-1305970 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References