Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 2126089..2126630 | Replicon | chromosome |
| Accession | NZ_LN813019 | ||
| Organism | Halomonas sp. R57-5 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0D6E807 |
| Locus tag | HALO_RS09720 | Protein ID | WP_035580252.1 |
| Coordinates | 2126089..2126388 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A0D6E7C4 |
| Locus tag | HALO_RS09725 | Protein ID | WP_035580249.1 |
| Coordinates | 2126388..2126630 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HALO_RS09695 | 2121894..2122229 | + | 336 | WP_022522982.1 | YqcC family protein | - |
| HALO_RS09700 | 2122310..2122936 | - | 627 | WP_035580258.1 | outer membrane beta-barrel protein | - |
| HALO_RS09705 | 2123494..2124192 | + | 699 | WP_081899087.1 | HNH endonuclease | - |
| HALO_RS09715 | 2125571..2126038 | + | 468 | WP_050713372.1 | hypothetical protein | - |
| HALO_RS09720 | 2126089..2126388 | - | 300 | WP_035580252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HALO_RS09725 | 2126388..2126630 | - | 243 | WP_035580249.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| HALO_RS09730 | 2126952..2130608 | - | 3657 | WP_050713373.1 | bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11622.42 Da Isoelectric Point: 10.3918
>T285571 WP_035580252.1 NZ_LN813019:c2126388-2126089 [Halomonas sp. R57-5]
MTLFTLTLAAKMDLRDIALFTQRRWGKKQRNVYLNQFDDSFWLLAETPDIGKSCDEIRQNYRKFPQGSHVIFYQQTGSHK
IRIIRILHKSMDVNAAFGA
MTLFTLTLAAKMDLRDIALFTQRRWGKKQRNVYLNQFDDSFWLLAETPDIGKSCDEIRQNYRKFPQGSHVIFYQQTGSHK
IRIIRILHKSMDVNAAFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D6E807 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D6E7C4 |