Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-couple_hipB |
| Location | 230419..231023 | Replicon | chromosome |
| Accession | NZ_LN794217 | ||
| Organism | Rickettsia monacensis strain IrR/Munich | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0B7J325 |
| Locus tag | RMONA_RS01125 | Protein ID | WP_023507259.1 |
| Coordinates | 230772..231023 (-) | Length | 84 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | RMONA_RS01120 | Protein ID | WP_023507258.1 |
| Coordinates | 230419..230775 (-) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RMONA_RS01075 | 226195..226806 | - | 612 | WP_023507257.1 | septum formation inhibitor Maf | - |
| RMONA_RS01080 | 226818..227033 | - | 216 | WP_010977828.1 | translation initiation factor IF-1 | - |
| RMONA_RS01090 | 227861..228139 | + | 279 | WP_046058410.1 | hypothetical protein | - |
| RMONA_RS01095 | 228272..228550 | + | 279 | WP_037230920.1 | hypothetical protein | - |
| RMONA_RS01100 | 228547..228809 | + | 263 | Protein_250 | hypothetical protein | - |
| RMONA_RS01105 | 228841..229064 | + | 224 | Protein_251 | hypothetical protein | - |
| RMONA_RS01110 | 229074..229595 | + | 522 | WP_037230923.1 | hypothetical protein | - |
| RMONA_RS01115 | 229618..230355 | + | 738 | WP_096001001.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| RMONA_RS01120 | 230419..230775 | - | 357 | WP_023507258.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| RMONA_RS01125 | 230772..231023 | - | 252 | WP_023507259.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| RMONA_RS01130 | 231214..231453 | - | 240 | WP_023507260.1 | BolA family transcriptional regulator | - |
| RMONA_RS01135 | 231620..231946 | + | 327 | WP_023507261.1 | ribosome silencing factor | - |
| RMONA_RS01140 | 231943..233670 | + | 1728 | WP_023507262.1 | monovalent cation:proton antiporter-2 (CPA2) family protein | - |
| RMONA_RS01145 | 233663..234142 | + | 480 | WP_023507263.1 | SH3 domain-containing protein | - |
| RMONA_RS07260 | 234182..234571 | + | 390 | Protein_260 | Rpn family recombination-promoting nuclease/putative transposase | - |
| RMONA_RS01155 | 234607..234846 | - | 240 | WP_023507265.1 | hypothetical protein | - |
| RMONA_RS09050 | 235213..235389 | - | 177 | WP_157699812.1 | hypothetical protein | - |
| RMONA_RS09540 | 235329..235472 | - | 144 | WP_172643952.1 | ankyrin repeat domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9880.70 Da Isoelectric Point: 10.6917
>T285568 WP_023507259.1 NZ_LN794217:c231023-230772 [Rickettsia monacensis]
MQYKLSFSKTALKNLLKISTNKRKEKLEQLKLNPYKENNNIKKLIGHDGYRLRIGDYRIIYRINKGKLEILVINVDVRGE
VYK
MQYKLSFSKTALKNLLKISTNKRKEKLEQLKLNPYKENNNIKKLIGHDGYRLRIGDYRIIYRINKGKLEILVINVDVRGE
VYK
Download Length: 252 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13683.82 Da Isoelectric Point: 5.9287
>AT285568 WP_023507258.1 NZ_LN794217:c230775-230419 [Rickettsia monacensis]
MSNKHIIEYQGKPAFVVIPFNEYQELINKKQCITDETLYTEAIAKNEEYFPEELVQKILDGENPIKVYREYRGLSQEQLA
IKIGKTKQYISSIEKGLRKGIIDTLKKLSTVLNVDLDM
MSNKHIIEYQGKPAFVVIPFNEYQELINKKQCITDETLYTEAIAKNEEYFPEELVQKILDGENPIKVYREYRGLSQEQLA
IKIGKTKQYISSIEKGLRKGIIDTLKKLSTVLNVDLDM
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|