Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-couple_hipB
Location 230419..231023 Replicon chromosome
Accession NZ_LN794217
Organism Rickettsia monacensis strain IrR/Munich

Toxin (Protein)


Gene name relE Uniprot ID A0A0B7J325
Locus tag RMONA_RS01125 Protein ID WP_023507259.1
Coordinates 230772..231023 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag RMONA_RS01120 Protein ID WP_023507258.1
Coordinates 230419..230775 (-) Length 119 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RMONA_RS01075 226195..226806 - 612 WP_023507257.1 septum formation inhibitor Maf -
RMONA_RS01080 226818..227033 - 216 WP_010977828.1 translation initiation factor IF-1 -
RMONA_RS01090 227861..228139 + 279 WP_046058410.1 hypothetical protein -
RMONA_RS01095 228272..228550 + 279 WP_037230920.1 hypothetical protein -
RMONA_RS01100 228547..228809 + 263 Protein_250 hypothetical protein -
RMONA_RS01105 228841..229064 + 224 Protein_251 hypothetical protein -
RMONA_RS01110 229074..229595 + 522 WP_037230923.1 hypothetical protein -
RMONA_RS01115 229618..230355 + 738 WP_096001001.1 autotransporter outer membrane beta-barrel domain-containing protein -
RMONA_RS01120 230419..230775 - 357 WP_023507258.1 helix-turn-helix transcriptional regulator Antitoxin
RMONA_RS01125 230772..231023 - 252 WP_023507259.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
RMONA_RS01130 231214..231453 - 240 WP_023507260.1 BolA family transcriptional regulator -
RMONA_RS01135 231620..231946 + 327 WP_023507261.1 ribosome silencing factor -
RMONA_RS01140 231943..233670 + 1728 WP_023507262.1 monovalent cation:proton antiporter-2 (CPA2) family protein -
RMONA_RS01145 233663..234142 + 480 WP_023507263.1 SH3 domain-containing protein -
RMONA_RS07260 234182..234571 + 390 Protein_260 Rpn family recombination-promoting nuclease/putative transposase -
RMONA_RS01155 234607..234846 - 240 WP_023507265.1 hypothetical protein -
RMONA_RS09050 235213..235389 - 177 WP_157699812.1 hypothetical protein -
RMONA_RS09540 235329..235472 - 144 WP_172643952.1 ankyrin repeat domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(65-117)


Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9880.70 Da        Isoelectric Point: 10.6917

>T285568 WP_023507259.1 NZ_LN794217:c231023-230772 [Rickettsia monacensis]
MQYKLSFSKTALKNLLKISTNKRKEKLEQLKLNPYKENNNIKKLIGHDGYRLRIGDYRIIYRINKGKLEILVINVDVRGE
VYK

Download         Length: 252 bp

Antitoxin


Download         Length: 119 a.a.        Molecular weight: 13683.82 Da        Isoelectric Point: 5.9287

>AT285568 WP_023507258.1 NZ_LN794217:c230775-230419 [Rickettsia monacensis]
MSNKHIIEYQGKPAFVVIPFNEYQELINKKQCITDETLYTEAIAKNEEYFPEELVQKILDGENPIKVYREYRGLSQEQLA
IKIGKTKQYISSIEKGLRKGIIDTLKKLSTVLNVDLDM

Download         Length: 357 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0B7J325

Antitoxin

Source ID Structure

References