Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
| Location | 1598377..1598908 | Replicon | chromosome |
| Accession | NZ_LN794158 | ||
| Organism | Candidatus Methylopumilus turicensis strain MMS-10A-171 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0B7J1T1 |
| Locus tag | BN1209_RS08085 | Protein ID | WP_045751719.1 |
| Coordinates | 1598627..1598908 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | A0A0B7IWL5 |
| Locus tag | BN1209_RS08080 | Protein ID | WP_045751718.1 |
| Coordinates | 1598377..1598640 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN1209_RS08060 | 1594825..1595277 | + | 453 | WP_045751715.1 | dihydroneopterin triphosphate diphosphatase | - |
| BN1209_RS08065 | 1595288..1596385 | + | 1098 | WP_045752078.1 | quinolinate synthase NadA | - |
| BN1209_RS08070 | 1596404..1597165 | + | 762 | WP_045751716.1 | endonuclease/exonuclease/phosphatase family protein | - |
| BN1209_RS08075 | 1597169..1598326 | + | 1158 | WP_045751717.1 | cardiolipin synthase ClsB | - |
| BN1209_RS08080 | 1598377..1598640 | + | 264 | WP_045751718.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| BN1209_RS08085 | 1598627..1598908 | + | 282 | WP_045751719.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| BN1209_RS08090 | 1599084..1599344 | - | 261 | WP_045751720.1 | hypothetical protein | - |
| BN1209_RS08095 | 1599454..1600695 | - | 1242 | WP_045751721.1 | hypothetical protein | - |
| BN1209_RS08100 | 1600738..1601961 | - | 1224 | WP_052661134.1 | site-specific integrase | - |
| BN1209_RS08105 | 1602163..1602435 | + | 273 | WP_045751722.1 | BrnT family toxin | - |
| BN1209_RS08110 | 1602416..1602691 | + | 276 | WP_144402567.1 | BrnA antitoxin family protein | - |
| BN1209_RS09190 | 1602748..1602909 | - | 162 | WP_171816522.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10845.71 Da Isoelectric Point: 10.1402
>T285567 WP_045751719.1 NZ_LN794158:1598627-1598908 [Candidatus Methylopumilus turicensis]
MRTIKQTSQFKRDFKRESKGKHKKTLAEDFKAVLILLLSDAALPEKYCDHAMIGNWNDHRNCHIKPDLILMYRLPDVKTL
QLVRLGSHSELSI
MRTIKQTSQFKRDFKRESKGKHKKTLAEDFKAVLILLLSDAALPEKYCDHAMIGNWNDHRNCHIKPDLILMYRLPDVKTL
QLVRLGSHSELSI
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B7J1T1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B7IWL5 |