Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | chpB-mazE/PRK09812-MazE |
Location | 921985..922591 | Replicon | chromosome |
Accession | NZ_LN794158 | ||
Organism | Candidatus Methylopumilus turicensis strain MMS-10A-171 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A0B7IUJ0 |
Locus tag | BN1209_RS04640 | Protein ID | WP_045751162.1 |
Coordinates | 921985..922326 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A0B7IZN7 |
Locus tag | BN1209_RS04645 | Protein ID | WP_045751163.1 |
Coordinates | 922343..922591 (-) | Length | 83 a.a. |
Genomic Context
Location: 920579..920812 (234 bp)
Type: Others
Protein ID: WP_045751159.1
Type: Others
Protein ID: WP_045751159.1
Location: 920885..921505 (621 bp)
Type: Others
Protein ID: WP_045751160.1
Type: Others
Protein ID: WP_045751160.1
Location: 921492..921980 (489 bp)
Type: Others
Protein ID: WP_045751161.1
Type: Others
Protein ID: WP_045751161.1
Location: 924809..926089 (1281 bp)
Type: Others
Protein ID: WP_045751165.1
Type: Others
Protein ID: WP_045751165.1
Location: 918390..920207 (1818 bp)
Type: Others
Protein ID: WP_045751158.1
Type: Others
Protein ID: WP_045751158.1
Location: 921985..922326 (342 bp)
Type: Toxin
Protein ID: WP_045751162.1
Type: Toxin
Protein ID: WP_045751162.1
Location: 922343..922591 (249 bp)
Type: Antitoxin
Protein ID: WP_045751163.1
Type: Antitoxin
Protein ID: WP_045751163.1
Location: 922646..924721 (2076 bp)
Type: Others
Protein ID: WP_045751164.1
Type: Others
Protein ID: WP_045751164.1
Location: 926128..926418 (291 bp)
Type: Others
Protein ID: WP_082048394.1
Type: Others
Protein ID: WP_082048394.1
Location: 926433..926849 (417 bp)
Type: Others
Protein ID: WP_045751166.1
Type: Others
Protein ID: WP_045751166.1
Location: 926854..927183 (330 bp)
Type: Others
Protein ID: WP_045751167.1
Type: Others
Protein ID: WP_045751167.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN1209_RS04615 | 918390..920207 | - | 1818 | WP_045751158.1 | ABC transporter ATP-binding protein/permease | - |
BN1209_RS04625 | 920579..920812 | + | 234 | WP_045751159.1 | VF530 family protein | - |
BN1209_RS04630 | 920885..921505 | + | 621 | WP_045751160.1 | hypothetical protein | - |
BN1209_RS04635 | 921492..921980 | + | 489 | WP_045751161.1 | hypothetical protein | - |
BN1209_RS04640 | 921985..922326 | - | 342 | WP_045751162.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
BN1209_RS04645 | 922343..922591 | - | 249 | WP_045751163.1 | hypothetical protein | Antitoxin |
BN1209_RS04650 | 922646..924721 | - | 2076 | WP_045751164.1 | TonB-dependent receptor | - |
BN1209_RS04655 | 924809..926089 | + | 1281 | WP_045751165.1 | divalent metal cation transporter | - |
BN1209_RS09015 | 926128..926418 | - | 291 | WP_082048394.1 | hypothetical protein | - |
BN1209_RS04660 | 926433..926849 | - | 417 | WP_045751166.1 | phage holin family protein | - |
BN1209_RS04665 | 926854..927183 | - | 330 | WP_045751167.1 | DUF883 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 11956.78 Da Isoelectric Point: 4.7718
>T285566 WP_045751162.1 NZ_LN794158:c922326-921985 [Candidatus Methylopumilus turicensis]
MAKFERGDVVRVCLNPTAGRETQGDFRPALVLSSAEVNDLGTAFIAPITQGGDFARFAGFAVSLTATGMETQGVVLVNML
RAVDLVARGAKKIEVAPAYVVEDALARLQAVFE
MAKFERGDVVRVCLNPTAGRETQGDFRPALVLSSAEVNDLGTAFIAPITQGGDFARFAGFAVSLTATGMETQGVVLVNML
RAVDLVARGAKKIEVAPAYVVEDALARLQAVFE
Download Length: 342 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B7IUJ0 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B7IZN7 |