Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpB-mazE/PRK09812-MazE |
| Location | 921985..922591 | Replicon | chromosome |
| Accession | NZ_LN794158 | ||
| Organism | Candidatus Methylopumilus turicensis strain MMS-10A-171 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | A0A0B7IUJ0 |
| Locus tag | BN1209_RS04640 | Protein ID | WP_045751162.1 |
| Coordinates | 921985..922326 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A0B7IZN7 |
| Locus tag | BN1209_RS04645 | Protein ID | WP_045751163.1 |
| Coordinates | 922343..922591 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN1209_RS04615 | 918390..920207 | - | 1818 | WP_045751158.1 | ABC transporter ATP-binding protein/permease | - |
| BN1209_RS04625 | 920579..920812 | + | 234 | WP_045751159.1 | VF530 family protein | - |
| BN1209_RS04630 | 920885..921505 | + | 621 | WP_045751160.1 | hypothetical protein | - |
| BN1209_RS04635 | 921492..921980 | + | 489 | WP_045751161.1 | hypothetical protein | - |
| BN1209_RS04640 | 921985..922326 | - | 342 | WP_045751162.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| BN1209_RS04645 | 922343..922591 | - | 249 | WP_045751163.1 | hypothetical protein | Antitoxin |
| BN1209_RS04650 | 922646..924721 | - | 2076 | WP_045751164.1 | TonB-dependent receptor | - |
| BN1209_RS04655 | 924809..926089 | + | 1281 | WP_045751165.1 | divalent metal cation transporter | - |
| BN1209_RS09015 | 926128..926418 | - | 291 | WP_082048394.1 | hypothetical protein | - |
| BN1209_RS04660 | 926433..926849 | - | 417 | WP_045751166.1 | phage holin family protein | - |
| BN1209_RS04665 | 926854..927183 | - | 330 | WP_045751167.1 | DUF883 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 11956.78 Da Isoelectric Point: 4.7718
>T285566 WP_045751162.1 NZ_LN794158:c922326-921985 [Candidatus Methylopumilus turicensis]
MAKFERGDVVRVCLNPTAGRETQGDFRPALVLSSAEVNDLGTAFIAPITQGGDFARFAGFAVSLTATGMETQGVVLVNML
RAVDLVARGAKKIEVAPAYVVEDALARLQAVFE
MAKFERGDVVRVCLNPTAGRETQGDFRPALVLSSAEVNDLGTAFIAPITQGGDFARFAGFAVSLTATGMETQGVVLVNML
RAVDLVARGAKKIEVAPAYVVEDALARLQAVFE
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B7IUJ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B7IZN7 |