Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 132844..133369 | Replicon | chromosome |
| Accession | NZ_LN794158 | ||
| Organism | Candidatus Methylopumilus turicensis strain MMS-10A-171 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0B7IXI4 |
| Locus tag | BN1209_RS00720 | Protein ID | WP_045750515.1 |
| Coordinates | 132844..133131 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0B7IXQ9 |
| Locus tag | BN1209_RS00725 | Protein ID | WP_045750516.1 |
| Coordinates | 133121..133369 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN1209_RS00695 | 128153..128719 | - | 567 | WP_045750510.1 | site-specific integrase | - |
| BN1209_RS00700 | 128921..130618 | + | 1698 | WP_045750511.1 | hypothetical protein | - |
| BN1209_RS00705 | 131170..131610 | - | 441 | WP_045750512.1 | hypothetical protein | - |
| BN1209_RS00710 | 131992..132453 | + | 462 | WP_045750513.1 | hypothetical protein | - |
| BN1209_RS00715 | 132521..132778 | - | 258 | WP_045750514.1 | hypothetical protein | - |
| BN1209_RS00720 | 132844..133131 | - | 288 | WP_045750515.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BN1209_RS00725 | 133121..133369 | - | 249 | WP_045750516.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| BN1209_RS00730 | 133495..134502 | - | 1008 | WP_045750517.1 | site-specific integrase | - |
| BN1209_RS00735 | 134576..135049 | - | 474 | WP_045750518.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
| BN1209_RS00740 | 135138..136574 | + | 1437 | WP_045750519.1 | M48 family metallopeptidase | - |
| BN1209_RS00745 | 136596..137036 | + | 441 | WP_045751868.1 | thiosulfate oxidation carrier protein SoxY | - |
| BN1209_RS00750 | 137038..137355 | + | 318 | WP_045751869.1 | thiosulfate oxidation carrier complex protein SoxZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10966.79 Da Isoelectric Point: 9.6740
>T285565 WP_045750515.1 NZ_LN794158:c133131-132844 [Candidatus Methylopumilus turicensis]
MIYELEFNEEALKEWNDLDGSIKAQFKKQLEKRLVNPHLPSARLGNDLEGCYKIKLQKIGYRLVYDVIDSRLVIIVLSVG
RRDGLAAYTKASKRI
MIYELEFNEEALKEWNDLDGSIKAQFKKQLEKRLVNPHLPSARLGNDLEGCYKIKLQKIGYRLVYDVIDSRLVIIVLSVG
RRDGLAAYTKASKRI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B7IXI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B7IXQ9 |