Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 35149..36283 | Replicon | plasmid II |
| Accession | NZ_LN774770 | ||
| Organism | Lactococcus piscium MKFS47 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | LACPI_RS11875 | Protein ID | WP_082095487.1 |
| Coordinates | 35149..36009 (-) | Length | 287 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | A0A0D6E0N2 |
| Locus tag | LACPI_RS11880 | Protein ID | WP_047916720.1 |
| Coordinates | 36011..36283 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LACPI_RS11840 | 30305..30688 | - | 384 | WP_047916713.1 | hypothetical protein | - |
| LACPI_RS11845 | 30708..31037 | - | 330 | WP_047916714.1 | hypothetical protein | - |
| LACPI_RS11850 | 31054..33024 | - | 1971 | WP_047916715.1 | MobA/MobL family protein | - |
| LACPI_RS11855 | 33309..33608 | + | 300 | WP_047916716.1 | hypothetical protein | - |
| LACPI_RS11860 | 33611..33910 | + | 300 | WP_047916717.1 | hypothetical protein | - |
| LACPI_RS11865 | 33887..34180 | - | 294 | WP_047916718.1 | hypothetical protein | - |
| LACPI_RS11870 | 34196..34708 | - | 513 | WP_047916719.1 | molecular chaperone DnaJ | - |
| LACPI_RS12800 | 34974..35132 | + | 159 | WP_157761154.1 | hypothetical protein | - |
| LACPI_RS11875 | 35149..36009 | - | 861 | WP_082095487.1 | zeta toxin family protein | Toxin |
| LACPI_RS11880 | 36011..36283 | - | 273 | WP_047916720.1 | antitoxin | Antitoxin |
| LACPI_RS11885 | 36304..36561 | - | 258 | WP_157761155.1 | hypothetical protein | - |
| LACPI_RS11890 | 36597..36806 | - | 210 | WP_047916722.1 | peptide-binding protein | - |
| LACPI_RS11895 | 36911..37768 | - | 858 | WP_047916723.1 | ParA family protein | - |
| LACPI_RS11900 | 37904..40048 | - | 2145 | WP_047916724.1 | type IA DNA topoisomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..55671 | 55671 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 287 a.a. Molecular weight: 32281.05 Da Isoelectric Point: 9.6225
>T285564 WP_082095487.1 NZ_LN774770:c36009-35149 [Lactococcus piscium MKFS47]
MANIVNFSEKQFEDRLEKNIERLTKNRLAVDEPTAFLLSGQPGSGKTSLRSVIDEETKGNAIIIDNDTFKQQHPNFEELA
KIYGKDVVAKVTPYSNQMTEAIINSLSEQGYNLVIEGTGRTTDVPIKTATMLKTKGYQTKMYVMAVPKIKSYLGTIERYE
DMFKRNPLTARATPKQAHDIVVSNLPSNLETLHKTGVFSDIRLYDRQGMKLYSSLETPSVSPKEPLESILNKKVSGKEIQ
STLERVEEKMVQNKHQDTPEFQAIRQKLDRFKPPIPPLPKLPGIGL
MANIVNFSEKQFEDRLEKNIERLTKNRLAVDEPTAFLLSGQPGSGKTSLRSVIDEETKGNAIIIDNDTFKQQHPNFEELA
KIYGKDVVAKVTPYSNQMTEAIINSLSEQGYNLVIEGTGRTTDVPIKTATMLKTKGYQTKMYVMAVPKIKSYLGTIERYE
DMFKRNPLTARATPKQAHDIVVSNLPSNLETLHKTGVFSDIRLYDRQGMKLYSSLETPSVSPKEPLESILNKKVSGKEIQ
STLERVEEKMVQNKHQDTPEFQAIRQKLDRFKPPIPPLPKLPGIGL
Download Length: 861 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|