Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4422922..4423574 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | D3VFY8 |
Locus tag | XNC2_RS19530 | Protein ID | WP_013185764.1 |
Coordinates | 4422922..4423311 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | N1NR17 |
Locus tag | XNC2_RS19535 | Protein ID | WP_010846167.1 |
Coordinates | 4423311..4423574 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS19505 | 4417994..4419208 | + | 1215 | WP_013185760.1 | 3-oxoadipyl-CoA thiolase | - |
XNC2_RS19510 | 4419294..4420637 | + | 1344 | WP_013185761.1 | phenylacetate--CoA ligase | - |
XNC2_RS19515 | 4420775..4421053 | + | 279 | WP_010846171.1 | DUF1778 domain-containing protein | - |
XNC2_RS19520 | 4421050..4421550 | + | 501 | WP_013185762.1 | GNAT family N-acetyltransferase | - |
XNC2_RS19525 | 4421638..4422579 | + | 942 | WP_013185763.1 | phenylacetic acid degradation operon negative regulatory protein PaaX | - |
XNC2_RS19530 | 4422922..4423311 | - | 390 | WP_013185764.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
XNC2_RS19535 | 4423311..4423574 | - | 264 | WP_010846167.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
XNC2_RS19540 | 4423989..4425029 | + | 1041 | WP_013141539.1 | IS481 family transposase | - |
XNC2_RS22465 | 4425313..4425890 | - | 578 | Protein_3880 | ISAs1 family transposase | - |
XNC2_RS19555 | 4425950..4426459 | + | 510 | Protein_3881 | IS6 family transposase | - |
XNC2_RS19560 | 4426647..4427519 | - | 873 | WP_013185768.1 | IS630 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14464.48 Da Isoelectric Point: 5.1131
>T285562 WP_013185764.1 NZ_LN681227:c4423311-4422922 [Xenorhabdus nematophila AN6/1]
MYMLDTNTVSYIFRQNQAVTAKLRTIPPSEICISSITEAELRFGLAKRQNHALEQVVNTFIDSITVYDWDQNAAKTYGTL
RAGMEQTGRTMGTMDQLIAAHALSRELTLVTSDSAFEMVIGLNIENWAK
MYMLDTNTVSYIFRQNQAVTAKLRTIPPSEICISSITEAELRFGLAKRQNHALEQVVNTFIDSITVYDWDQNAAKTYGTL
RAGMEQTGRTMGTMDQLIAAHALSRELTLVTSDSAFEMVIGLNIENWAK
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|